KEGG   Mus musculus (mouse): 258671
Entry
258671            CDS       T01002                                 

Gene name
Olfr826, MOR210, MOR210-2
Definition
(RefSeq) olfactory receptor 826
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258671 (Olfr826)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258671 (Olfr826)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258671 (Olfr826)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258671
NCBI-ProteinID: NP_666887
MGI: 3030660
Ensembl: ENSMUSG00000059862
Vega: OTTMUSG00000056691
UniProt: Q8VFU6
Position
10; 10 D3
AA seq 313 aa
MGDRETSNHSDMTDFILVGFRVSPELHILLFLLFLLVYAMILLGNLGMMAIIMTDPRLNT
PMYFFLGNLSFIDLFYSSVIAPKAMSNFWTESKSISFAGCVAQLFLFALFIVAEGFLLAA
MAYDRFIAICNPLLYSVHMSTRLCTQLVAGSYFCGCISSVLQTSMTFTLSFCASRAIDHF
YCDTRPVQRLSCNNLFVHKIVSFSLSSIIILPTVIVIIVSYMYIVSTVLKIRSVEGRKKA
FSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKLASLCFSLVTPMLNPLIYSLRNKDVRD
ALSKLLEKKKFIL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggcgacagggaaacaagcaatcactcagatatgactgactttatccttgtaggcttc
agggtcagtcctgagctccatatcctccttttcctgctctttctgcttgtgtatgccatg
atccttctaggaaaccttgggatgatggccatcattatgactgatcccaggctgaacaca
ccaatgtatttcttcctaggcaacctctccttcatcgacctcttctactcatctgttatt
gcaccaaaggctatgagcaacttttggacagagagcaagtccatctcatttgcaggctgt
gtggctcagctttttctctttgcactgttcattgtggctgaaggatttctcctggcagcc
atggcttatgaccgtttcattgccatctgcaacccactcctgtattctgttcacatgtcc
acacgtctctgcactcagctggtggcaggctcttatttttgtggctgtatcagctctgtt
ctccagactagcatgacatttactttatccttttgtgcttctcgagccattgaccacttt
tactgtgatactcgaccagttcagagattatcttgtaataatctttttgtccataaaata
gtatccttttcattatccagcatcattatcttaccaactgtcatagtcatcattgtttcc
tacatgtatattgtgtccactgttctaaagatacgatccgtggagggaaggaagaaagcc
ttctccacttgcagctctcacctgggtgttgtgagtgtgctgtatggtgctgttttcttc
atgtatctcacccctgacagatttcctgaactgagtaagctggcttctttgtgcttttcc
ctagtcacacctatgctgaaccctctgatttactctctgagaaacaaagatgttagagat
gctttaagcaaacttctagagaagaaaaagttcattctttaa

DBGET integrated database retrieval system