KEGG   Mus musculus (mouse): 258683Help
Entry
258683            CDS       T01002                                 

Gene name
Olfr262, MOR214-1, MOR214-9
Definition
(RefSeq) olfactory receptor 262
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258683 (Olfr262)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258683 (Olfr262)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258683 (Olfr262)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258683
NCBI-ProteinID: NP_666899
MGI: 3030096
Ensembl: ENSMUSG00000067519
Vega: OTTMUSG00000042679
UniProt: Q8VFV8
Position
19; 19 A
AA seq 312 aa AA seqDB search
MIARGNSTEITQFILLGFTDLPIIIILLFVTFLLIYITTLTWNLSLIVLIRMDSHLHTPM
YFFLCNLSIIDLCYVTSTVPKMLSNFFQERQTNSFVGCIVQNFIFSTMGLSESCLMAAMA
YDRYAAICNPLLYASIMSPTLCVLMVLASYLSGLTASLLQLFALLRLHFCGTNVIKHFFC
DMPQLLVLSCTDTFFVQVLTAILTMIFGFVNMLVIMISYVYIVLSILKITSAKGRSKAFN
TCASHLTAVSLFYTSSIFVYLSSSSGGSSSFDRFVSVFYTVVIPMLNPLIYSLKNREIKD
AMKRLQKKTICN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgattgccaggggaaacagcacagagatcacccagttcatcctcttgggattcacagat
ttacccataataataatactgctctttgtcacatttctgctcatctacattacaactctc
acctggaatctgtccctcattgtgttaataagaatggattcacacctccacactcccatg
tatttcttcctgtgcaacctttccatcatagatctttgctatgttaccagtacagtccca
aaaatgctctcaaactttttccaggaaaggcaaactaacagttttgtgggctgcattgtt
cagaatttcatcttttccaccatggggttgagtgagtcttgtctcatggcagccatggcc
tatgaccggtatgctgctatttgtaaccctcttctgtatgcatcgattatgtcacccact
ctttgtgtactgatggtgctggcatcctatctctctgggctcactgcttctttactacag
ttgtttgctttgcttcgtctccatttttgtggaactaatgtcatcaagcacttcttttgt
gacatgccacagttgttagttctgtcctgcacagacactttctttgtacaagtcctaact
gccatattaacaatgatctttggatttgtaaacatgctagttatcatgatatcttatgtc
tatattgtcttgtccattctgaagatcacttcagctaagggcagatccaaggcattcaac
acctgtgcttctcacttgacagctgtttccctattctatacctccagtatctttgtctat
ttgagttcaagttctggtggctcctccagttttgacagatttgtgtctgttttctacact
gtggtgattcccatgctgaacccattgatatacagtctgaagaacagagaaatcaaagat
gctatgaagaggttgcagaaaaagacaatctgcaactag

DBGET integrated database retrieval system