KEGG   Mus musculus (mouse): 258715
Entry
258715            CDS       T01002                                 

Gene name
Olfr421-ps1, MOR105, MOR105-3, Olfr, Olfr42, Olfr421, Olfr422-ps1
Definition
(RefSeq) olfactory receptor 421, pseudogene 1
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258715 (Olfr421-ps1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258715 (Olfr421-ps1)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258715 (Olfr421-ps1)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258715
NCBI-ProteinID: NP_666931
MGI: 3030255
Ensembl: ENSMUSG00000091950
Vega: OTTMUSG00000042404
Position
1; 1 H3
AA seq 315 aa
MENGNLSTVTVFVFTGFPQLKNGGLLYFFPLLFIYIFIVTGNLMIFFAVRLDTRLHNPMY
NFISIFSFLEMWYTTATIPKMLSNLISEQKTISFIGCLLQMYFFHSLGNTEGTLLTVMAI
DRYVAICNPLRYPNIMTPRLCAQLTAGSCVFGFLILLPEIVWISTLPFCGPNQITQIFCD
FTPLLKLACTDASVILVQDVIHALAILITSLIISLSYIRIIVVILSISSTEGRKKAFSTC
AAHIAVFLLFFGSVALMYLRFSATYTPFWDNTIALTFSVFAPLFNPIIYSLRNKDMKDAI
NKLICTQKVSNESHR
NT seq 948 nt   +upstreamnt  +downstreamnt
atggagaatggaaacctatctaccgtgactgtgtttgtcttcactgggttcccccagctc
aagaatggtggcctcctgtacttttttcctctactgttcatttacatctttattgtgaca
ggaaacctgatgatcttttttgctgtaaggttggacactcgtcttcataatcccatgtac
aatttcataagtatcttctcatttcttgagatgtggtatacaacagctaccatacctaag
atgctctccaatctgatcagtgagcaaaagaccatttccttcattggctgcctcttgcag
atgtacttcttccattcacttggaaataccgaagggacccttctgactgtcatggctatt
gacaggtatgttgccatctgtaatccactccgctacccaaacatcatgacacccaggctc
tgtgctcagctcactgctggttcttgtgtatttggcttcctcatccttctacctgagatt
gtgtggatttctactctacctttttgtggccccaatcaaatcactcagatattctgtgat
ttcacccctttgttgaagttagcctgtacagatgcctcagtgatcttggttcaagatgtg
atacatgctctcgctattctgatcacaagtctgattatttctctttcttacataagaatt
attgttgttatcctgagcatctcttcaacagaaggtcgcaaaaaagctttttccacttgt
gctgcccacattgctgtcttcctcttgttttttggcagtgtggcccttatgtatcttcga
ttctctgccacctatacaccattctgggacaacaccattgctcttacattttctgtgttt
gcccctcttttcaatcctattatatacagcctgagaaataaggacatgaaagatgcaatt
aacaaactcatttgtactcaaaaagtatccaatgaatcacataggtaa

DBGET integrated database retrieval system