KEGG   Mus musculus (house mouse): 258726
Entry
258726            CDS       T01002                                 
Symbol
Or52ab4, MOR23-1, Olfr599
Name
(RefSeq) olfactory receptor family 52 subfamily AB member 4
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258726 (Or52ab4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258726 (Or52ab4)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258726 (Or52ab4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DNA_ligase_A_N
Other DBs
NCBI-GeneID: 258726
NCBI-ProteinID: NP_666942
MGI: 3030433
Ensembl: ENSMUSG00000073950
UniProt: Q8VG01
Position
7:102987219..102988268
AA seq 315 aa
MGYTNLSYLNPGTVILIGIPGLEHVQFWIGFPFFVVCLVALLGNLFLLIIIPTERSLHQP
MYIFLAVLAATDLGLCLAIAPKMLAIFWFGSCSMAFDACLTQLFFIHALQGMESGVLLAM
AFDRYVAICDPLRHTAVLTPLFLLRVVLVVAIRATVLVGVLPILLKRLQWFHSVVIVHSY
CEHMAVVKLAAEDVRINKSYGLFVAFAILGFDMIFVFISYILIFRAVFRLPQKEARSKAF
NTCTAHIVVFLEFYILAFFSFFSHRFGHVSPYVHILLSTIYLLLPPALNPIVYGVKTKEI
RKWVVQIFVLKSNTQ
NT seq 948 nt   +upstreamnt  +downstreamnt
atgggctataccaacttgtcatacctgaacccagggacagtgattctgattggcatccct
ggactggagcatgtgcagttttggattggatttcccttctttgttgtatgccttgtggct
ttgctgggaaacctcttcctgctaatcattatccccacagaacgcagtctacaccaaccc
atgtacattttcttggcagtactcgcagctactgaccttggtctctgcctagccattgcc
cctaagatgttggccatcttctggtttggctcctgttccatggcttttgatgcttgcctc
acccagctcttcttcatccatgccttgcaaggaatggaatctggcgttctgcttgccatg
gcctttgaccgatatgtcgccatctgcgatcctctgaggcacacagccgtccttacacct
ttatttttacttagagtcgttctggtggttgcaattcgggcaactgtactcgttggggtt
ttacccattctcctcaagcgactgcaatggttccactctgttgtgattgttcattcttac
tgtgagcacatggctgtagtcaagctggcggcagaagatgtccgtattaataaatcatat
gggctctttgtggcttttgcaattctaggttttgacatgatatttgttttcatctcctac
attttgattttccgagctgtttttcgtcttcctcagaaagaggcacgaagcaaagcattc
aacacttgtacggctcatattgttgtcttcctggagttttatatccttgcctttttttcc
tttttcagtcaccgttttggtcacgtatcaccgtatgtccacatcttattgtctaccatc
tatctacttctgcccccggcccttaaccccattgtgtatggtgtgaagaccaaggagatc
cgcaaatgggttgtccaaatttttgttctgaagtctaatactcagtaa

DBGET integrated database retrieval system