KEGG   Mus musculus (mouse): 258763Help
Entry
258763            CDS       T01002                                 

Gene name
Olfr1104, MOR207-1
Definition
(RefSeq) olfactory receptor 1104
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258763 (Olfr1104)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258763 (Olfr1104)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258763 (Olfr1104)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx UPF0139 Cobl Glycoprotein_G
Motif
Other DBs
NCBI-GeneID: 258763
NCBI-ProteinID: NP_666978
MGI: 3030938
Ensembl: ENSMUSG00000075166
Vega: OTTMUSG00000013719
UniProt: A2AVB5
Position
2; 2 D
AA seq 310 aa AA seqDB search
MTENNFTKVTVFMFSGFSDHPELQVSLFLIFLFIYLFTVWGNIGLILLIRIDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKAVVDFQSTQKSISFVGCFVQMYFFVGLVCSECFLLGSMAY
DRYVAICNPLLYSVIMSQKVCNWLAVIPYMIGFTNSLISICVISSLPLCDPYINHFFCDT
TALLALSCVDAFSTELVIFVLAGFTLLSSLLIITFTYVTIISAILRIQSAAGRWKAFSTC
ASHLTGVTVFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIHRKHLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaataatttcacaaaagtgacagtcttcatgttcagtggattttcagatcac
ccagaattacaagtcagtctgttcttaatattccttttcatctatttattcactgtgtgg
ggcaacattgggttaatcttgttaattagaattgactctcagcttcacacacctatgtat
tttttcctcagcaatttagcattcattgacatattttattcctccactgtaacacccaag
gcagtagttgatttccagtccacacagaaatcaatatcctttgtaggctgctttgttcag
atgtatttctttgttggtttggtgtgcagtgagtgtttccttctgggatccatggcttat
gatcgctatgtagcaatctgcaatcccttactatattctgtgattatgtcccagaaggtg
tgcaactggctggcagtaataccatacatgataggcttcacaaattctctgatatccatc
tgtgtgataagcagtttgcctctctgtgatccctacatcaatcatttcttttgtgacacc
acagctcttttagccctgtcctgtgtagatgccttcagcacggaattggtgatctttgtt
ctagctgggttcacactcctcagttctcttctcattatcactttcacttatgtgaccatc
atctcagccatccttaggatacagtcagcagctggcaggtggaaggctttttctacatgc
gcctctcacctcacaggggtcactgtcttctatggctctttgattttcacctatttgcaa
cctgataacacatcatccctcacccaagcacaggtagcctctgtgttctacaccattgtt
attcccatgctgaacccactgatctacagtctgagaaacaaagatgtgaaaaatgctctt
ctgagagtcatccacagaaaacaccttctgtaa

DBGET integrated database retrieval system