KEGG   Mus musculus (mouse): 258773
Entry
258773            CDS       T01002                                 

Gene name
Olfr818, MOR110, MOR110-2
Definition
(RefSeq) olfactory receptor 818
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258773 (Olfr818)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258773 (Olfr818)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258773 (Olfr818)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258773
NCBI-ProteinID: NP_666988
MGI: 3030652
Ensembl: ENSMUSG00000058071
Vega: OTTMUSG00000056635
UniProt: Q8VG46
Position
10; 10 D3
AA seq 318 aa
MKNQSLEVVFVLLGLTGDPQLQILIFLFLFFNYILSLMGNLVIILLTLLDPHLKTPMYFF
LRNFSFLEIAFTTVCIPRFLTSILLGEKMILYNACVAQLFFFFLLGATEFYLLAAMSYDR
YVAICRPLHYPIIMNSKVCHLLVLSSWVTGFFVILPPLLLGLKLDFCASKTVDHFLCDTS
VLQLSCTDTRLIELMAFALAIMTLIITLILVLFSYTLIIKTILKFPSAQQRKKAFSTCSS
HMVVVSITYGSCIFMYVKTSAKERVTLNKGIAVLNTSVAPLLNPFIYTLRNQQVKEAFKN
VIHRFCSFKNHETRFRHQ
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaagaaccagtctctggaggtagtgttcgttttgcttggactgacaggagaccctcag
ctacaaattctgattttcctgtttctgtttttcaattacatcttgagcctgatgggaaat
ttagtgatcatccttctcaccctgctggatcctcacctcaaaactccaatgtacttcttc
ctccggaatttctccttcttagaaattgcattcactacagtctgcattcccaggttcctc
acaagcattcttttaggagagaaaatgattttgtataatgcttgtgtggctcagttattc
ttcttttttctactaggggccacagagttctacctcctggctgccatgtcctatgatcgc
tatgtagccatctgcagaccactgcactaccccatcatcatgaatagcaaagtatgtcac
ctacttgtcctcagttcctgggtaactgggttctttgtcatcttaccccctttgctcttg
ggactcaaactggatttctgtgcttccaaaactgttgatcacttcctttgtgacacttct
gtcctgcagctgtcttgcacagacacacggttaatagaactgatggcttttgccttagct
ataatgacacttatcattaccttgatcttagtgcttttctcctacacactcatcatcaaa
accatcctaaagttcccttcagctcaacaaaggaaaaaagccttttccacctgctcctca
cacatggttgttgtctccattacttatgggagttgtatcttcatgtatgttaaaacctca
gccaaggagagagtgaccttaaataaaggaatagctgtgctcaacacctctgtggcccct
ttgctaaaccctttcatttataccctgaggaaccagcaggtaaaggaagctttcaaaaat
gtgattcatagattttgttcttttaaaaaccatgagacaagatttagacatcaataa

DBGET integrated database retrieval system