KEGG   Mus musculus (mouse): 258826
Entry
258826            CDS       T01002                                 

Gene name
Olfr27, MOR171-6, MTPCR56
Definition
(RefSeq) olfactory receptor 27
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258826 (Olfr27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258826 (Olfr27)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258826 (Olfr27)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258826
NCBI-ProteinID: NP_667040
MGI: 109308
Ensembl: ENSMUSG00000049708
Vega: OTTMUSG00000062275
UniProt: Q9EQ90
Position
9; 9 A5.1
AA seq 311 aa
MAAGNRCTVTEFFLVGLSEKSELQLPLFLLFTGIYLITVAGNLGMITLIGLSSHLHTPMY
YFLSSLSFIDFCQSTVVIPKMLMSFLTEKNIISYSGCMAQLYFFLIFGIAECYTLAAMAY
DRYVAICNPLLYNVTMSYQIYSSLISGIYIFAVFCSSLNTGFMLRTQFCNLDVINHYFCD
LLPLLNLASSNTFIIEILILVIATLNVFIPVLTIITSYIFIIATILCIHSREGKFKAFST
CSSHISAVAIFYGSGAFTYLQPSSLNSMGQAKVSSVFYTTVVPMLNPLIYSLRNKDVSIS
LKKILERKKFM
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcagcaggaaaccgctgcacagtgactgagttcttcttagttgggctctcagagaag
tcagaactccagctgccactcttcctgctcttcacaggaatctatctgatcactgtggca
gggaacctgggcatgatcacactaattgggctcagttcccacctgcacacacccatgtac
tatttcctcagcagtctgtccttcattgacttctgtcagtccacagttgttattcctaaa
atgctcatgagctttctgacagagaagaacatcatctcttactctggatgtatggctcag
ctctacttcttcctcatatttggtattgcagagtgctacacattagctgcaatggcatat
gaccgatatgttgctatttgtaaccccttgctttacaatgtaaccatgtcctatcagatt
tacagttctctgatttcaggaatatatatttttgctgtgttctgttcatccttaaacact
ggcttcatgcttaggactcagttctgcaatttagatgtgattaaccactatttctgtgat
cttctacccctcttgaatcttgcatcctctaatacgtttatcattgaaatattgattcta
gttattgctacactgaatgtctttatcccagtgctgaccattattacttcctacatcttc
attattgccaccatcctctgcattcactccagggagggcaagttcaaggcttttagtact
tgcagttcccacatctctgctgttgctatcttttatggttctggtgcattcacgtactta
cagccctcatcactgaattctatgggccaagcaaaagtgtcctctgtgttttatactact
gttgtacccatgctgaaccccttaatctacagcctgaggaataaggatgtcagtatttca
ttgaagaaaatacttgaaagaaaaaaattcatgtaa

DBGET integrated database retrieval system