KEGG   Mus musculus (mouse): 258828
Entry
258828            CDS       T01002                                 

Gene name
Olfr133, MOR256, MOR256-6
Definition
(RefSeq) olfactory receptor 133
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258828 (Olfr133)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258828 (Olfr133)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258828 (Olfr133)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258828
NCBI-ProteinID: NP_667042
MGI: 2177516
Ensembl: ENSMUSG00000063240
UniProt: Q8VG94
Position
17; 17 B1
AA seq 312 aa
MILINKSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSILDPCLHSPMY
FFLTNLSFLDMCYTTSIVPQMLINLWGSTKTISYMRCAVQLYFFHTMGGTECVLLALMSF
DRYVAICKPLHYTLIMNQRNCVLLVSTVWLTGIFYAVSEATVTLQLPLCGHNKMDHLVCE
IPILIKTACGEKETNELALSVVCIFLLAIPLCLILASYASIGHAVFKIKSSEGRKKAFGT
CSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGA
LGKLFRNIFISK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgatattgatcaataaaagtcacccagaagagtttattctacttggttttgcagaccgt
ccttggctggaacttcctctctttattattcttctggtaacataccccacagccatgatt
ggaaacattgccatcattctcgtgtctatattagacccctgtctccatagccctatgtat
ttcttcctcaccaacctctcctttctggacatgtgctacaccacaagcattgtacctcag
atgttaattaacctttggggctctacaaagaccatcagctacatgaggtgtgcagttcag
ctttatttcttccacacaatggggggtacagagtgtgtcctcctggctcttatgtccttt
gaccgatatgtggccatctgcaaacccctgcactataccctcataatgaatcagcgcaac
tgtgtcctgttagtgtccactgtgtggctgactggaattttctatgctgtctcagaggcc
actgtaacactgcaattgcctctttgtggccacaataaaatggatcatttggtgtgtgag
attccaattctgataaaaactgcttgtggtgaaaaagagactaatgagcttgctctctca
gtagtatgcatttttcttttagctattcctctgtgtttaattcttgcctcctatgctagt
attggacatgctgtctttaaaatcaaatcttcagagggaagaaaaaaggcctttgggaca
tgttcctctcatctcattgtagttctcttgttctatggtccagccattagtatgtatctt
cagcctccttcctctattacaaaagaccaacctaagttcatggctctcttctatggagta
gtaactcctacattgaaccccttcatctataccctgaggaataaggatgtaaagggggca
ttaggtaaactattcaggaacatttttatatcaaagtaa

DBGET integrated database retrieval system