KEGG   Mus musculus (mouse): 258868Help
Entry
258868            CDS       T01002                                 

Gene name
Olfr894, MOR170-5
Definition
(RefSeq) olfactory receptor 894
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258868 (Olfr894)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258868 (Olfr894)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258868 (Olfr894)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258868
NCBI-ProteinID: NP_667079
MGI: 3030728
Ensembl: ENSMUSG00000070311
Vega: OTTMUSG00000061826
UniProt: Q9EQB2
Position
9; 9 A5.1
AA seq 313 aa AA seqDB search
MMQMTMENKSSVSEFILMGLTDQPELQLPLFVLFLMNYTATVMGNLSLMNLICLNSNLHT
PMYFFIFNLSFIDFCYSMVFTPKMLMSFVVEKNTISFRGCMTQLFFFCVFINAESYVLTA
MAYDRYVAIGQPLMYQVVMSPKICCLLIFGSYLMGFISATAHTGCMVRLRFCDSNIINHY
MCDIFPLLQLSCSSTYVNELMSYIAVGTAIILCSLIILVSYAMILFNIIHISSGKGWSKA
LGTCGSHIITVSLFYGSGLLAYVNPSSAETVGQAKFFSVFYTLLVPMLNPLIYSLRNKDV
KLAMKKSWKRITS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaatgactatggaaaataaatcttcagtgtcagaatttattcttatgggattg
acagaccaacctgagctccagctgcccttatttgttctgttcttgatgaactacacagct
actgtaatgggcaacttgagcttaatgaatctcatttgcctaaactcaaaccttcacacc
cccatgtactttttcatcttcaatctgtccttcattgatttctgttattcaatggtcttt
accccaaaaatgctgatgagttttgttgtagagaagaacaccatctccttcagaggatgc
atgactcagctgtttttcttctgtgtttttataaatgctgagagttatgtgctgacagca
atggcctatgatcgctatgtggccatcggccagccattaatgtaccaggttgttatgtct
cctaagatctgttgtctgttaatatttggttcttacttgatggggtttattagtgccaca
gctcacacaggatgtatggtcaggctcagattttgtgattctaacatcattaaccactat
atgtgtgacatcttccctctcctccagctctcctgtagtagcacgtatgtcaatgagctt
atgagttatattgcagtgggtacagctatcattttatgtagcctcattatcttagtctca
tatgctatgatcctcttcaatatcattcatatttcatcaggtaagggttggtccaaagcc
ttgggcacttgtgggtctcacatcataactgttagtcttttctatggatctgggcttctt
gcttatgtcaatccatcatctgctgaaacagtgggtcaggcaaaatttttctctgtgttt
tacactttattggtgcccatgttgaaccctcttatttatagcctcagaaacaaggatgtc
aagcttgctatgaagaaatcctggaaaagaattacaagctga

DBGET integrated database retrieval system