KEGG   Mus musculus (mouse): 258880Help
Entry
258880            CDS       T01002                                 

Gene name
Olfr218, MOR267-3, Olfr1405-ps1, Olfr218-ps1
Definition
(RefSeq) olfactory receptor 218
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258880 (Olfr218)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258880 (Olfr218)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258880 (Olfr218)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF4293
Motif
Other DBs
NCBI-GeneID: 258880
NCBI-ProteinID: NP_001001809
MGI: 3030052
Ensembl: ENSMUSG00000046643
Vega: OTTMUSG00000050166
UniProt: E9PWV2
Position
1; 1 H3
AA seq 313 aa AA seqDB search
MPKKNSTVVAEFLFEGFSSFDWQHRLGFFIVFLTLYLLTLSGNMIIVTIIRLDRHLHTPM
YFFLSMLSISETFYTIAIIPRMLAGLLNPYQAIDIQGCATQLFFYLTFGINNCFLLTAMG
YDRYVAICNPLRYSVIMGKKACILLASGSLGIGLSMAIVQVTSVFGLPFCDGFVIAHFFC
DVRPLLKLACTDTTINEIINFIVSVCVLVLPMSLVFISYVVIISTILKIASAEGRKKAFA
TCASHLTVVIIHYGCASIIYLKPKSQTSLGQDRLISVTYTVITPLLNPVVYSLRNKEVKE
ALRKAIGRRPLSS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaaaaactccacagttgtggccgagttcctctttgaaggtttctccagcttt
gattggcagcacaggcttggcttctttattgtgttcctaacgctgtaccttctgactctg
tctggcaacatgatcattgtgacaattattcgtctggaccgccatctccatacacccatg
tacttttttctaagcatgctctccatctctgagactttctataccattgccattattcca
cgaatgctagctggcctccttaatccttaccaggccatagatattcaaggttgtgcaaca
cagctcttcttttatctaacttttggcatcaacaactgttttctcctcacagcaatgggt
tatgaccgctatgtggccatctgcaatcctctaaggtattcggtcatcatgggtaagaag
gcctgtatcctcttagcatctgggtcactgggaattggcctgagcatggctattgtccag
gttacatcagtgtttggcctaccattctgtgatgggtttgttattgcccacttcttctgt
gatgtgagacccctgctgaaactggcctgcacagataccactatcaatgagataatcaac
tttattgtcagcgtgtgtgtccttgtgttacccatgagtcttgtcttcatctcctatgtt
gttatcatctctaccatccttaagattgcctcagctgaaggccggaagaaggcctttgcc
acctgtgcctcccaccttactgtggtcatcatccactatggctgtgcctcaataatctac
ctaaaaccaaagtcccagacttccctagggcaggacaggctcatctcagtgacttacact
gtcatcacccctctactgaacccagtggtatacagtttgagaaacaaagaggtcaaagag
gctctacgaaaggccataggacgtaggcctctttcctcttaa

DBGET integrated database retrieval system