KEGG   Mus musculus (mouse): 258926Help
Entry
258926            CDS       T01002                                 

Gene name
Olfr476, MOR204-3
Definition
(RefSeq) olfactory receptor 476
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258926 (Olfr476)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258926 (Olfr476)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258926 (Olfr476)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 258926
NCBI-ProteinID: NP_667135
MGI: 3030310
Ensembl: ENSMUSG00000095301
Vega: OTTMUSG00000059956
UniProt: Q8VGI4
Position
7; 7 E3
AA seq 310 aa AA seqDB search
METQNHTTVTEFILLGLTESSTLRVILFMVFLGIYTVTLVGNFSIISLIRSCPQLHTPMY
LFLSHLAFVDIGFSTSITPTMFKGFLGNRLVLSVAACIAQFCITVTFGTVECFLLAVMAY
DRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGAFTSCLSILSFCGPNQIDHFFCD
FPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYAYILITILKMRSTEGRQKAFST
CTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEA
LRKAIIRIFP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagactcaaaaccacacaactgtgacagagttcattcttctggggttaacagagagc
tccacactacgtgtcatcctatttatggtatttctaggaatatatactgttactttagtg
ggaaatttcagcatcatcagtttaataagaagttgcccccaactccacactcccatgtat
ctgttccttagccatctggcttttgtagacattgggttttccacatcaatcacaccaaca
atgtttaaaggatttcttggaaatagactggtactctctgtagctgcttgtatagcccaa
ttctgcatcacagtgacatttgggacagttgagtgcttcctcctagctgtcatggcttac
gaccgctatgtggccatctgttcacccctgctctattcaacacatatgtctcccaggatc
tgtttccttttagttggagcttcatatgtaggtggctgtgtgaattcaggggcatttact
agttgtctgtcgattctgtccttctgtggaccaaatcagatagatcactttttctgtgac
ttccctgctgtgttgaaactttcttgctcagatgtctccatcattggaattattccttca
atctctgctggatccatcattgtgatcacagtgtttgtcatagctgtctcctacgcctac
attctcatcaccatcctgaagatgcgctccactgagggccgacagaaggccttctccacc
tgcacctcccacctcactgcagtcactctctactatggaaccattaccttcatttatgtg
atgcccaaatcaaactactctactgcacaaaacaagatactgtctgtattctacacagtg
gtgatccccatgctcaaccccctcatctacagtctgagaaacagagatgtaaaagaggct
ctcaggaaggccatcatcagaatatttccatag

DBGET integrated database retrieval system