KEGG   Mus musculus (mouse): 258929
Entry
258929            CDS       T01002                                 

Gene name
Olfr799, MOR114, MOR114-2
Definition
(RefSeq) olfactory receptor 799
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258929 (Olfr799)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258929 (Olfr799)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258929 (Olfr799)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258929
NCBI-ProteinID: NP_667138
MGI: 3030633
Ensembl: ENSMUSG00000094734
Vega: OTTMUSG00000056616
UniProt: Q8VGI7
Position
10; 10 D3
AA seq 311 aa
MKNRTVTTFILLGLTDDIRLQTLLFIFLLFSYMLSLSGNLTIITLTLIDPHLKTPMYIFL
KNFSFLEISLTTACIPRFLYSLSSGDKSIAYAACISQLLFIDIFAVTEFFLLAIMSYDRY
VAICKPLHYMTIMNSRVCKNFIFFCWVAALIIVLPPISLGLGLEFCDSDIVDHFCCDAAP
LLKISCSDTWLIEQMVIAGAVLTFIITFVCVVLSYGYIIKTILRFPSAKQRKKAFSTCSS
HMIVVSITYGSCIFIYVKPSSKDNVAINKGISLIIVSISPMLNPFIYALRNKQVKQAFNY
SIKKVAFLSKM
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaaaaaccgaacagtaacaactttcattttgctgggtctgacagatgacattaggctg
caaactctactttttatctttctgcttttttcttacatgttgagtttatctggtaaccta
accatcatcaccctcactctgattgacccccatcttaaaacacctatgtatattttcctc
aaaaatttctccttcttagaaatttcacttacaactgcttgtattcccagatttctatac
agcctatcatctggggataagtccattgcctatgctgcttgtatcagtcaactgttgttt
atagacatctttgcagttacagaattttttctcttggctatcatgtcctatgatcgctat
gtggccatctgtaaacctctgcattacatgaccatcatgaatagcagagtctgcaagaac
ttcatcttcttctgttgggtagcagcactgatcatcgttctcccaccaattagcctaggt
ttgggcctggaattctgtgactcagatattgttgaccatttttgttgtgatgcagctcct
ctcctgaaaatctcttgttcagacacatggttgatagaacagatggtgatagctggtgcg
gtgttgacattcatcatcacctttgtgtgtgttgtcctttcttatggttatatcatcaag
accattctgagatttccctctgccaagcaaaggaaaaaggccttttccacctgttcttcc
cacatgattgttgtttccattacttatggtagctgcatcttcatttatgtcaaaccttca
tccaaggataatgtagctatcaataaagggatttcacttattattgtatcaatttcacca
atgttgaatccctttatttatgcactgagaaacaagcaagtaaagcaagctttcaattac
tcaattaaaaaagttgcatttctctcaaagatgtaa

DBGET integrated database retrieval system