KEGG   Mus musculus (mouse): 258935
Entry
258935            CDS       T01002                                 

Gene name
Olfr790, MOR112, MOR112-1
Definition
(RefSeq) olfactory receptor 790
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258935 (Olfr790)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258935 (Olfr790)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258935 (Olfr790)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258935
NCBI-ProteinID: NP_667144
MGI: 3030624
Ensembl: ENSMUSG00000044025
Vega: OTTMUSG00000056571
UniProt: Q8VGJ3
Position
10; 10 D3
AA seq 322 aa
MPLEAESIMRNSTAVTDFILLGLTDDPLWQIVVFTFLLVTYMLSVTGNLIIIILTLSDAH
LMTPMYFFLRNFSLLEISFTSVCIPRFLVTIVTGDRTISYNGCVAQLFFFIFLGVTEFYL
LAAMSYDRYVAICKPLHYTTIMSNRVCILLVFSSWFAGFMIIFPPIILLLQLDFCASNII
DHFICDSSPILQLSCSNTHFLELMAFSLAVVTLMVTLTLIILSYTNIIRTILRIPSTNQR
KKAFSTCSSHMIVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRN
QQVKQAFKNMIQRIFFSSKNLP
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcctttagaagcagagagtattatgagaaattccacagcagtgacagactttattctt
cttggactgacagatgatccactgtggcagattgtggttttcacatttcttcttgttacc
tacatgctaagtgtgactgggaacctcatcattatcatcctcaccctctcagatgcccat
ctgatgacacccatgtatttcttccttcgaaatttctcactcctagaaatatcatttaca
tctgtctgcattcccagattccttgtcactattgtgacaggagacagaactatttcctac
aatggttgcgtggctcagctattctttttcattttcttaggagtgacagaattttacctt
ctggctgccatgtcctatgaccgttatgtggccatctgcaaacctctacactacacaaca
atcatgagcaaccgtgtgtgcattcttcttgtctttagctcatggtttgcaggattcatg
attatctttccaccaattatccttctgttacagttagacttctgtgcctccaacataatt
gaccactttatctgtgactcttctccaattttgcagctttcttgctcaaacactcacttt
ctcgagctcatggcattttcattagctgtggtaacactcatggtcaccttgacattaatt
attctttcctacacaaatattattcggacaattctgagaattccttctacaaatcagaga
aaaaaggccttttcaacttgttcctcccatatgatagttgtctccctctcttatggcagc
tgcatcttcatgtacattaagccttctgcaagggagagggtgactttaagcaaaggagta
gctgtactcaacacttctgtggctcctctcctgaaccccttcatctatacactgaggaac
cagcaagtgaagcaagccttcaaaaacatgatccagagaatcttcttttcttcaaagaat
ttaccatga

DBGET integrated database retrieval system