KEGG   Mus musculus (mouse): 258968Help
Entry
258968            CDS       T01002                                 

Gene name
Olfr1247, MOR231-6
Definition
(RefSeq) olfactory receptor 1247
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258968 (Olfr1247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258968 (Olfr1247)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258968 (Olfr1247)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 258968
NCBI-ProteinID: NP_667177
MGI: 3031081
Ensembl: ENSMUSG00000075081
Vega: OTTMUSG00000014150
UniProt: A2AT78
Position
2; 2 E1
AA seq 314 aa AA seqDB search
MGETNNVTEFVLLGLTQDPTGQKALFVMFLLMYIVTIVGNLLIVGTVIASPSLNSPMYFF
LAFLSLMDAVYSTAILPKLLKDLVCDKKTISFTACLVQLFVEHLFGGAEVFLLVVMAYDR
YVAICKPLHYLTVMNQQVCISLLVVAWVGGFAHALVQVLSVYKLPFCGPNVIDHFGCDMY
PLLALVCTDTYFIGLTVVANNGAMCMVVFVLLLFSYGIILSSLKTHSQEGRRKALSTCSS
HIMVVVLFFVPCIFMYVRPVSNFPIDKSISVFYTAITPMLNPLIYTLRNSEIKNSMGKLW
SKMISIDRVRIFAY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggagagactaacaatgtcacagaatttgtccttctgggcctcactcaggatcctact
gggcaaaaagcattgtttgtcatgtttttgctcatgtacattgtgactattgtgggcaac
ctgctcatcgtggggacagtgattgccagcccctccttgaattccccaatgtacttcttc
cttgcctttctgtcactcatggatgctgtttattctactgccatcttgcccaagttgctt
aaagacttagtttgtgataaaaagaccatctccttcacagcttgtctggttcagctcttt
gtagagcacttatttggtggtgctgaggtcttccttctggtggtgatggcctatgatcgc
tatgtggccatctgtaagccactgcactatttaactgtcatgaatcaacaggtttgtatc
tcacttttggtggtagcctgggttgggggatttgcacatgctctggttcaagttctctct
gtatataaacttcctttctgtggacctaatgtcattgatcactttggctgtgacatgtat
cctttattggcacttgtgtgcactgacacctactttattggcctcacggtagttgccaat
aatggagccatgtgtatggtagtctttgtccttcttctattttcctatggaattatctta
agctcccttaagactcacagtcaggaagggaggcgcaaagccctgtccacctgcagctcc
cacatcatggttgttgttcttttctttgttccctgtatattcatgtatgttagacctgtc
tccaacttccctattgataaatctatttctgttttttatacagctattactcccatgttg
aatcctttgatatatacattgagaaattcagagattaaaaattctatgggaaagctctgg
agtaaaatgataagtatagatagagtaagaatttttgcatactga

DBGET integrated database retrieval system