KEGG   Mus musculus (mouse): 258991Help
Entry
258991            CDS       T01002                                 

Gene name
Olfr1496, MOR127-1
Definition
(RefSeq) olfactory receptor 1496
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258991 (Olfr1496)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258991 (Olfr1496)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258991 (Olfr1496)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Calici_PP_N
Motif
Other DBs
NCBI-GeneID: 258991
NCBI-ProteinID: NP_667200
MGI: 3031330
Ensembl: ENSMUSG00000048356
Vega: OTTMUSG00000059633
UniProt: B9EHG2
Position
19; 19 A
AA seq 317 aa AA seqDB search
MNMDQENQTSISEFILLGLSNQAEKQKLIFVIFLSMYLVTVIGNSLIILAIGLDIHLHTP
MYLFLANLSFADISSSSTSVPKMLMNIQTNSQSISYEGCITQMYFSIVFVVIDNFLLGVM
AYDRYVAICHPLNYTNIMHPRFCLLLSFCPWALSNIVALTHTLLANQLIFCNHNTIQHFF
CDLAPLIKLSCSDAMINELVKFVVGLSVITFPFALILFSYVCIIRDVLRISSTEGKWKAF
STCGSHLTIVFLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMLNPFIYSLRNKDMK
GALRKLINKSHLLPLMS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggatcaagaaaaccaaaccagcatctctgaatttatcctcctgggtctctcc
aaccaggctgagaagcaaaaactcatctttgtgattttcttgagtatgtacctggtcact
gtgattggaaacagtctcataattctggccattggtttggatatacatcttcatactcct
atgtatcttttccttgccaacctatcttttgctgatatttcctcctcttcgacttcagtc
cctaaaatgctaatgaatattcagaccaatagtcaatccatttcctatgagggctgcatt
acacaaatgtacttttctattgtgtttgttgtcattgacaattttcttttgggggtaatg
gcttatgatcgatatgtggctatctgccaccctctgaattatacaaacatcatgcacccc
aggttctgtcttttactttctttctgtccatgggctctaagcaatattgttgccctgaca
catactcttctggccaatcaattgattttttgcaaccataacaccatccaacacttcttc
tgtgacttggcccctctgatcaaactttcctgctcagatgcaatgatcaatgaacttgta
aaatttgttgtgggattatcagtcatcacctttccctttgccctcattctcttctcctat
gtctgcatcatcagggatgtactgagaatttcatccacggaaggaaagtggaaagccttc
tctacctgtggctctcacctgacaattgtattccttttctatggtaccattgtaggggtt
tactttttcccttcatccactcaccctgaggacacagacaagattggtgcagtactcttc
acagtggtgacacccatgttaaaccctttcatctatagcctgagaaataaggacatgaaa
ggtgcccttaggaagctcatcaataaaagtcatttgctccctttgatgtcatga

DBGET integrated database retrieval system