KEGG   Mus musculus (mouse): 259018Help
Entry
259018            CDS       T01002                                 

Gene name
Olfr1049, MOR187-1
Definition
(RefSeq) olfactory receptor 1049
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259018 (Olfr1049)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259018 (Olfr1049)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259018 (Olfr1049)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 259018
NCBI-ProteinID: NP_667227
MGI: 3030883
Ensembl: ENSMUSG00000075194
Vega: OTTMUSG00000013661
UniProt: A2ARZ0
Position
2; 2 D
AA seq 308 aa AA seqDB search
MGQPNITMPTEFILMGVTQTAELKLPLFAVFLTIYAITVVGNLGMIILTKLDSRLQTPMY
FFIRHLAFIDLGNSTAICPKMLVNFVVDKNNITYYACATQMACFILFIVSELSILSSMAY
DRYVAICNPLLYSAIMSQRRCQVLIGIPYLYSIFQALLFPIRYFTLSFCGANIISHFYCD
VVPLLPLICSHVEETELLTILFSAFNLISSLVVVLLSYMLILLTIFQMRSAEGRKKAFST
CGSHLTVVVVFYGSLLFMYVQPKSAHSFEYDKAASVFYTLVIPMLNPLIYSLRNKEVKNA
FHRVFKNL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaccaaatataacaatgccaactgagttcatcctgatgggagtcacacagact
gctgagctgaaactcccactgtttgcagtcttcctcactatctatgcaatcaccgtggtg
ggaaacctcggcatgatcattttgaccaaactggactctcgcctacaaacccctatgtac
tttttcatcagacaccttgctttcattgatcttggaaattccactgccatctgccccaag
atgctggtgaattttgttgtggataaaaacaacatcacctattatgcttgtgccacacaa
atggcatgcttcattctgttcattgtcagtgaactttcaatcttgtcctccatggcctat
gaccgctatgtggctatctgcaaccctctgctctatagtgctataatgtctcagagacgc
tgtcaagtgcttattggaattccatatctctacagtatcttccaggctctgctgttccct
attaggtatttcacattaagcttctgtggtgctaatatcataagccatttctattgtgat
gttgtccccttactacctttgatctgttcacatgtagaagagacagaattattgactata
ttgttttcagccttcaatttaatctcttctcttgttgttgttcttttgtcttacatgcta
attttgttaaccatatttcaaatgcgttctgcagaaggtaggaaaaaagctttctccact
tgtggttcccatctgacagtggtggttgtgttctacggttctctactcttcatgtatgtt
cagcctaaatctgctcactcatttgaatatgacaaagcagcatctgtgttttatacttta
gtgatccccatgcttaaccccttgatttatagtttaaggaacaaagaggtaaaaaatgcc
tttcatagagtatttaagaatctatga

DBGET integrated database retrieval system