KEGG   Mus musculus (mouse): 259040Help
Entry
259040            CDS       T01002                                 

Gene name
Olfr1416, MOR103-3
Definition
(RefSeq) olfactory receptor 1416
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259040 (Olfr1416)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259040 (Olfr1416)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259040 (Olfr1416)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 259040
NCBI-ProteinID: NP_667249
MGI: 3031250
Ensembl: ENSMUSG00000067064
Vega: OTTMUSG00000048560
UniProt: Q8VGU4
Position
1; 1 D
AA seq 312 aa AA seqDB search
MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTIILTVWSSASLHRPMY
YFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFIGCMTQLYFFSSLVCTECVLLASMAY
DRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFISSATFCGSNVLNHFFCD
ISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGHITLAVLRIPSATGRWRAFST
CASHLTVVTFFYMAMIFMYVRPQAIDTRSSNKLISAVYTVLTPMMNPLIYCLRNTEFKDA
VRRTLGLGNTPQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaggggggagaacatcaccaaggtcagcaccttcatcctgctgggcttccccacagcc
cctgagctgcaatacctgctcttcctcctcttcctgctcgcctacctctttgtgctggtg
gagaacctgaccatcatcctcactgtctggagcagcgcctccctccacagacccatgtac
tacttcctgggatccttgtctttcctagagatctggtatgtgtcagacatcatccccaaa
atgctggatggcttcctcttgcagaggaaacgcatctctttcattggatgcatgactcag
ctctacttcttcagctccctggtatgtacagagtgtgtactcctggcttccatggcctat
gaccgctatgtggccatctgccaccccctgcgctaccaagtcatcatgaccacagggctg
tgtgtccagcttgtggccttctcttttgctagtggcttcaccatctctgtgattaaggtc
tactttatctccagcgccaccttctgtggctccaatgtcttgaaccacttcttctgtgac
atctcccccatcctcaagctggcctgcactgacttctctactgcagagctggtggacttc
atcctggccttcatcattctggtgttcccactcttggccaccattctctcctatggccac
atcaccctggctgtgctgcgcatcccttcagccacaggccggtggagagccttctccacc
tgtgcttcccacctcactgtggtcaccttcttctacatggccatgatcttcatgtatgtg
cgaccccaggccattgatacccggagctccaacaagctcatctctgctgtgtacaccgtc
ctcacgcccatgatgaatcctttgatctactgtctgaggaatactgaatttaaggatgct
gtgagaagaactttgggattgggaaatactccccagtag

DBGET integrated database retrieval system