KEGG   Mus musculus (mouse): 259070
Entry
259070            CDS       T01002                                 

Gene name
Olfr829, MOR147-1
Definition
(RefSeq) olfactory receptor 829
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259070 (Olfr829)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259070 (Olfr829)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259070 (Olfr829)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 259070
NCBI-ProteinID: NP_667278
MGI: 3030663
Ensembl: ENSMUSG00000051414
Vega: OTTMUSG00000061149
UniProt: Q8VGX1
Position
9; 9 A2
AA seq 321 aa
MYSIRFTMNMKYINQTVVSGFILLGLTDDTKLQLIIFSVFLSMYLATVIGNLLIILATNF
DSHLHTPMYFFLSVLSFNDIFLVTCTIPKMLVNIQTGNQNITYGGCLTQVCFVLVSVGME
NCLLAAMAYDRYVAICHPLRYRIIMNPYLCILMVAFSMIGSMANALVNGLMVLHLSFCTE
LIIPHFFCELTQITKLACSNTLIDNILIYISSCIFGGVPLSGIILSYCQIATTVLRMSSS
EGRYKAFSTCGSHLSVVFLFYGTGFGVYISSTITESSRKSAVASVLYSVVPQMINPFIYS
LRNRDMKEALKKLISRILFPL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtattccatcagattcaccatgaacatgaaatatataaaccaaacggttgtgtcagga
ttcattctcctgggactcacagatgataccaagctgcaacttattatcttcagtgtcttt
ctttccatgtaccttgcaacagtcataggaaacctcctgattattctggccaccaacttt
gactctcatctccatacccccatgtacttctttctctctgttctttcttttaatgatatc
tttttagttacatgcactattccaaagatgctggtgaatatacaaacaggaaaccagaac
atcacttatggaggatgtctgactcaggtctgctttgtcttggtgtctgttggcatggaa
aattgccttcttgcagcaatggcctatgaccgctatgttgctatttgccatccacttagg
tataggatcataatgaacccctatctttgtatcctaatggtagcattttctatgataggg
agcatggcaaatgccctggtcaatggtctaatggtattacatctgtccttctgcacagaa
ctcataatcccacatttcttctgtgaacttacacagattactaaacttgcctgttccaac
actcttattgacaacatactaatatacatttcatcttgcatatttggtggtgttcctctt
tctggcatcattttgtcatattgtcaaattgcaaccactgtcttgagaatgtcatcatca
gaaggaagatataaagcattttccacctgcgggtctcatctgtcagttgttttcttattt
tatggaaccggttttggggtctatatcagctcaacaattacagaatcatccaggaagagt
gctgtggcttcagtgctgtattcagtagtccctcaaatgataaatccctttatctatagt
ctgaggaacagagacatgaaagaagccttgaaaaaactcatcagtaggatattatttcct
ctatga

DBGET integrated database retrieval system