KEGG   Mus musculus (house mouse): 259073
Entry
259073            CDS       T01002                                 
Symbol
Or52e19b, MOR32-14_i, MOR32-2, Olfr603, Olfr603-ps1, Olfr604
Name
(RefSeq) olfactory receptor family 52 subfamily E member 19B
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259073 (Or52e19b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259073 (Or52e19b)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259073 (Or52e19b)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 259073
NCBI-ProteinID: NP_667281
MGI: 3030437
Ensembl: ENSMUSG00000059874
UniProt: L7N1Y4
Position
7:complement(103032269..103033207)
AA seq 312 aa
MPSNNETASHPSLFHLLGIPGLEAFHIWIAFPFFVVYPIALVGNFTILCVIKNEQSLHQP
MFYFLALLSFIDLGLSTSTIPKMLGIFWFNLREISFEGCLIQMFFIHTYTGMESVVLLAM
AIDRFVAICYPLRYTSVLTNKVVAVMASVVIGRPVLLVIPFCPLLKRLPFCGHYIIPHTY
CEHMGIARLACANIRINIIYGLFTIAALIFDLILIAFSYAWILQAVFRLPSRDARHKALS
TCGSHVCVILAFYTPAFFSFMTHRFGRNVPRYIHILLANLYVVVPPCLNPVIYGVRTKQI
REGVLKIFVKKE
NT seq 939 nt   +upstreamnt  +downstreamnt
atgccctctaataatgaaactgcttcacacccctctctcttccatctgctgggcattcct
gggctggaagctttccatatctggatagcctttcctttctttgttgtttatccgatagca
cttgtggggaatttcacaatcctctgtgtgatcaagaatgaacagagtcttcaccagccc
atgttctactttcttgccctcctctctttcattgatcttggcctctctacttccaccatt
cccaagatgctgggtatcttctggttcaaccttagggagataagctttgaaggctgcctc
atccaaatgttcttcatccacacttacacaggcatggaatctgttgtactcctggccatg
gcaattgaccgttttgttgccatctgttacccacttaggtatacctctgttctcaccaac
aaagtggtggctgtcatggcatcggttgtaatagggagacctgtccttcttgtcatccct
ttttgtcccctcctaaaacgcctgcccttttgtggacactatattattcctcatacctac
tgtgaacatatggggatagcacgtctagcctgtgctaacataaggataaacatcatctat
ggcttattcaccattgctgctctgatctttgatttaattctcattgctttctcctatgct
tggatcctacaggctgttttccgccttccttccagggatgccagacacaaagcccttagc
acatgtggttcccatgtctgtgtcatcttagccttttacacaccagcatttttctctttt
atgacccataggtttggtagaaatgttcctcgttatattcacatcctcttggccaatctc
tatgtggttgtccctccttgtttaaatccagtcatttatggagtgaggacaaaacaaatt
agggagggagtcttaaaaatatttgtaaagaaagaatag

DBGET integrated database retrieval system