KEGG   Mus musculus (house mouse): 259084
Entry
259084            CDS       T01002                                 
Symbol
Or51ah3, MOR19-2, Olfr615
Name
(RefSeq) olfactory receptor family 51 subfamily AH member 3
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259084 (Or51ah3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259084 (Or51ah3)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259084 (Or51ah3)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 259084
NCBI-ProteinID: NP_667291
MGI: 3030449
Ensembl: ENSMUSG00000073947
UniProt: Q8VGY4
Position
7:103209686..103210627
AA seq 313 aa
MSEFNTTFQPSVFILTGLRGLVGARLWLGPLLSLMYITTLAGNCTVIYLVRTERSLQEPQ
YQFLSMLAGADIVLSVSTLFSVLKVFIFDLYEIAFDSCLAQLFFIHTSSSMGSGILLAMA
FDRFVAISHPLQYTTILTNSRVTRMGLAAFLRGVALMMPLPILLKRLPFCKGQLLSYSYC
IHPNVMKLACGQVKINIFYGLVLVIFSFGVDFLLIAISYALIFQAVMGIASREGQMKALN
TCLSHIFIVFIYYGPLLAITVMHRISRRSSPIAHAVLGNIYLFMPPMLNPIVYSLKTKQI
RSALRKSLKIQRR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtctgaatttaataccacatttcaaccttctgtcttcatcctcactggcctcagaggg
ctggtgggtgcccgcctgtggctgggaccactcctgagcctgatgtacatcaccacattg
gcagggaactgtactgtaatttatttagtaaggactgaaaggagtctgcaggagcctcag
taccaatttttgtctatgctggctggggctgacattgtcttgtctgtctctacactgttc
tctgtgctaaaagtctttatctttgacctctatgaaattgcatttgacagttgccttgct
cagctcttcttcatccatacatcttcttccatgggttcaggaatcttgttagctatggct
tttgaccgctttgtggccatcagtcaccccctgcaatatacaacaatactgacgaactca
cgagtcaccaggatgggactggcagcttttctgaggggtgtagcgctcatgatgcccttg
cctatactgcttaagagattaccattctgcaaggggcagctgttgtcctactcctactgt
atccacccaaatgtcatgaaactagcctgtggccaagtcaagatcaatattttctatggt
cttgttttggttatattttcgtttggggtggactttttgctcatagctatttcttatgct
ctgatatttcaagcagttatggggatcgcttctagagaaggtcagatgaaagcgctcaat
acttgtttgtctcatatctttattgtctttatctactatggccctttgctggcaataact
gtaatgcatcggatcagccgcagaagttctccaatagcacatgcagtcctgggaaatatc
tatctttttatgcccccaatgcttaacccaattgtgtatagcctgaagaccaagcagatt
cgctctgccttgagaaaatctttgaagatccagaggagatga

DBGET integrated database retrieval system