KEGG   Mus musculus (mouse): 259106
Entry
259106            CDS       T01002                                 

Symbol
Olfr552, MOR28, MOR28-1
Name
(RefSeq) olfactory receptor 552
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259106 (Olfr552)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259106 (Olfr552)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259106 (Olfr552)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Epiglycanin_C
Other DBs
NCBI-GeneID: 259106
NCBI-ProteinID: NP_667313
MGI: 3030386
Ensembl: ENSMUSG00000073973
Vega: OTTMUSG00000060019
UniProt: E9Q545
Position
7; 7 E3
AA seq 317 aa
MLVNNITSTHPVAFLLMGIPGLEHLHIWISIPFCSAYTLAVLGNCTLLFIIRVDAALHEP
MYLFLAMLAAIDLVLSSSTLPKMLSLFWFRDREINFHACLIQMFFLHSFAIMESAMLLAM
AFDRYVAICKPLHYTTILTKPLIIKIGLAAVTRAVTLMTPLPFLLRRFHYCRGTVIAHCY
CEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSYIFILRAVLQLASQEARYKAF
GTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ
IRERVLGLFLRKDLKGE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgttggttaataatatcacctcaacccacccagtggccttcttgttgatgggtatccca
ggcctagagcacttacatatttggatctccatccccttctgctcagcctataccttggct
gtgcttggcaactgcaccctccttttcatcattcgggttgatgcagctctccatgagccc
atgtacctctttctggccatgttggcagcaatagatctggtcctttcctcgtcaacactg
cccaaaatgctctccctgttctggttcagggatcgggaaatcaatttccatgcctgcctt
atccagatgttctttctccattcctttgctatcatggagtcagcaatgttgttggccatg
gccttcgatcgttatgttgccatatgcaaacctctgcactataccaccatcctgaccaag
cccctcatcatcaagattggcctggctgctgtgactcgggctgtgacactaatgactcca
cttccttttctgctcagacgtttccattactgtcgaggcacagtgattgcccactgctac
tgtgaacacatggctgtggtgaggctggcatgtggggacacacgcttcaataacatctat
ggcattgctgtggccatgtttattgtggtgctggacctgctcttcgttatcttgtcttac
atcttcatccttcgtgctgttctccagcttgcctcccaggaggctcgctacaaggccttt
gggacatgtgtgtcgcatataggtgccatcttagccttctatacacctgtagtcatctcc
tcagtcatgcatcgtgtggctcgtcgggctgctcctcatgtccacatactccttgctaat
ttctatcttcttttcccacctatggtcaatcctatcatctatggtgtcaagactaagcag
attagagagcgagtcttagggctattcctcagaaaggatttaaaaggtgagtga

DBGET integrated database retrieval system