KEGG   Mus musculus (mouse): 259109Help
Entry
259109            CDS       T01002                                 

Gene name
Olfr978, MOR223-3
Definition
(RefSeq) olfactory receptor 978
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259109 (Olfr978)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259109 (Olfr978)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259109 (Olfr978)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 259109
NCBI-ProteinID: NP_667316
MGI: 3030812
Ensembl: ENSMUSG00000044292
Vega: OTTMUSG00000062405
UniProt: E9Q985
Position
9; 9 A5.1
AA seq 311 aa AA seqDB search
MSNTSIVTTFFLSGLPHPPVLDSMLFGIFLVIYILTVLGNLLILTVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSTGGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYD
RYLAISYPLRYSSMMGGRMCALLAAGTWFTGSLHSAVQTTLTFHLPYCGPNQIQHYFCDA
PPILKLACADTSANEMVIFVNIGVVASGCFFLISLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRDAVDGIVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
IKYGSVLPQDK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacaagcatagtgaccacattcttcctctcaggtcttccccacccaccagtc
ctggactccatgctctttgggatcttccttgtgatttatattcttactgtgttgggaaac
cttctcatcctgacggtgatcagggtggattcccacctccacacaccaatgtactacttc
ctcaccaacctctcctttattgacatgtggttctccacagtcacagtgcctaaaatgctg
atgactttggtgtccacagggggcggggctatctccttccacagctgtgtggcacagctc
tattgcttccacttcctgggtagcaccgagtgtttcctgtacacagtcatgtcctatgat
cgctacttggccatcagttacccactcaggtacagcagcatgatgggtggcagaatgtgt
gccctcctggcagcaggaacatggttcactggttccctgcactctgctgtccagactaca
ttgaccttccatttgccctactgtggtcccaaccagatccagcattatttctgtgatgca
cctcccatcctcaagctggcctgtgcagacacctcagccaatgagatggtcatctttgtg
aatatcggggtagtggcttcggggtgtttttttctgatttcgctgtcctatgtgtccatt
gtctgctccatcctgaggattcgcacttcagagggccggcacagagctttccagacatgt
gcctcacactgcatcgtggtcctctgtttctttggccctggtctcttcatctacctgagg
ccaggctccagggatgctgtagatggaattgtggccgttttctacactgtgttgacaccc
ctactcaaccctgttgtgtacaccctgaggaacaaagaagtgaagaaagcactgttgaaa
ataaaatatgggtctgtgcttcctcaggataaataa

DBGET integrated database retrieval system