KEGG   Mus musculus (mouse): 259165
Entry
259165            CDS       T01002                                 

Gene name
Olfr814, MOR113, MOR113-5, MOR113-8
Definition
(RefSeq) olfactory receptor 814
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    259165 (Olfr814)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    259165 (Olfr814)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    259165 (Olfr814)
SSDB
Motif
Pfam: 7tm_4 7tm_1 WSS_VP
Other DBs
NCBI-GeneID: 259165
NCBI-ProteinID: NP_997042
MGI: 3030648
Ensembl: ENSMUSG00000059134
Vega: OTTMUSG00000056631
UniProt: Q7TRH4
Position
10; 10 D3
AA seq 310 aa
MKNHTRQIEFILLGLTDNPQLQTLIFVSLLLNYLLSMLGNLSIIALTLLDPILKTPMYFF
LRNFSFLEILFTTTCIPRFLITIVTQEKTISYNGCFCQLFFYIFLGATEFFFLATMSYDR
YIAICKPLHYASIMNSKVCHQLVLGSWVTGFLVIFPPLIIGLDLDFCASNVIDHFLCDVS
PLLQLSCSDTSLLEVMAFILALMTLIVTLIIVILSYAHIVKTIIKFPSAQQKKKAFSTCS
SHMIVVSLTYGSCIFIYIKPSANERVTLSKGIAVLNTSVAPLLNPFIYTLRNKQVKQACG
AILRKIFSAS
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaagaaccatacaagacagatagagtttatccttcttggactgacagacaatcctcag
ttacagactctgatttttgtgtcccttttactaaattacttgctgagtatgctagggaat
ttatctatcattgccctcactctgctagatcccattctcaagacaccaatgtattttttc
ctccgtaatttctctttcttagaaattttatttacaacaacctgcattcccagattttta
atcactattgtaacacaggagaagacaatttcctataatggctgtttttgtcaattattc
ttttatatatttttgggggccacagagtttttcttcttggctaccatgtcctatgaccgc
tatattgccatctgcaaacccttgcactatgcatctatcatgaacagtaaagtttgtcat
cagcttgtcctgggttcttgggtaactggattcctggttattttcccaccactgattatt
ggccttgatttggatttctgtgcttcaaatgtcattgaccatttcctttgtgatgtttct
cctctcctacaactctcttgctcagacacaagtttactagaagtgatggctttcatctta
gctctcatgacactcattgtcacattaataatagtcatcctttcttatgctcacattgtc
aagacaattataaaattcccttctgctcagcaaaagaaaaaggccttttccacttgttct
tctcacatgattgttgtttcccttacttatgggagttgcatattcatctacataaagcct
tcagcaaatgaaagagtgactttgagcaaaggaatagctgtgctcaacacttcagttgcc
cctttgttgaacccatttatttatacactgaggaataagcaagttaaacaagcctgtgga
gcaatacttagaaaaatattttctgcttcataa

DBGET integrated database retrieval system