KEGG   Mus musculus (mouse): 259172Help
Entry
259172            CDS       T01002                                 

Gene name
Mfrp, rd6
Definition
(RefSeq) membrane frizzled-related protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CUB Fz Ldl_recept_a CUB_2 Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 259172
NCBI-ProteinID: NP_667337
MGI: 2385957
Ensembl: ENSMUSG00000034739
Vega: OTTMUSG00000033669
UniProt: Q8K480
Position
9 A5.1; 9 24.6 cM
AA seq 584 aa AA seqDB search
MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQ
PDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTT
PNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHI
QVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVS
FVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANC
SAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAEC
KFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAI
NTTESGCPWAEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCL
GLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTIL
PPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAASLEACSQP
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactatgacgacgtcatcctccgtccagaggcgagtgagttgagcaagacagag
ttctgtaatcctgctttcgacccggaagcagggccatcctgccctccaccagcgttacag
agggatgtcggcagccggctccaagccccctggcatgcccagcgtctccgggggctacag
cccgactgccacttctcctggttctgtattctgcttctcagtggcctgctgctcctgctg
ctggggctactggtggctgtcatcctggctcagttgcaggctacatccctccccaggact
accaagaacccactgctcacccgaggcctcacccccatgggtgtcattcccagcaccacc
cctaacaccaccaccaccaccaccactaccaccccagcaaggacagggcagcaggaggca
gccatgagccctacacaccagaccacctgtggaggcctccttcctggtcccagtggtttc
ttcagcagccctaactacccagacctctacccacccctcagccactgtgtctggcatatc
caggtagccgcgggccagacaatacagctcaagattcaagccctcagcatagagagtatg
ctcacctgtctttttgatcgcttggaaattatctcagagcctacaggccctctcctcagg
gtgtgtggtaaaacacctcctgccacattaaacaccaataccagccacctccgtgtgtcc
ttcgtctctgataacgatgtggaagggtctggtttccaggcctggtaccaagcagtggcc
cctggacattggagctgtgcccataatgagttccactgtgaccttctcctctgcctgaag
cgtgactctgtatgtgacggtattaccgagtgtgccgatggcagtgacgaggccaactgc
agtgccaagacgttggggtgtggagggaacctgactgggctctatggcgtattctctacc
ccaaactatccacagcactaccctcaccaacagctttgcacctggtacatcgaagtgcct
gtgggatacgggataagactggagttccacaacttcagtctggaagcacaggctgagtgc
aagtttgactacgtggaagtgtacgaggccagcaacctgggaaccttcagcttcctgggc
aggttctgtggagcagagccaccactcaacgttgtctcctcgatgcaccagctggctgta
atcttcaagacggatcttggtatcagcagcgggggctttctagccacctaccaggccatc
aatactacagagagtgggtgtccctgggcagagttctgccagagcggaggatatagggat
ctgcaatggatgtgtgacttatggaaagactgtgcaaatgacagcaacgacaactgcagc
agccacttgtccccacaaccagacctgacctgtgaacctgtccaggtggagatgtgcctt
ggactaagctacaataccacggcctttcctaacatctgggtgggcctggccacgcagaca
gaggtgacagacatcctccgaggctacaagagtctgacaagtctaccctgctaccagact
ttccagaggttcctctgtggactgcttgtgcctcgatgcacctcactgggcactatccta
cccccttgtcgttccgtctgccaggcggcggagcagcagtgccagtctagcctggcatta
ttgggcaccccctggcctttcaactgcaacaggctgcccgtggcagctagcctggaagct
tgctcccagccctga

DBGET integrated database retrieval system