KEGG   Mus musculus (mouse): 259279Help
Entry
259279            CDS       T01002                                 

Gene name
Tubgcp3, GCP3, Spc98p
Definition
(RefSeq) tubulin, gamma complex associated protein 3
  KO
K16570  gamma-tubulin complex component 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    259279 (Tubgcp3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    259279 (Tubgcp3)
   04147 Exosome [BR:mmu04147]
    259279 (Tubgcp3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     259279 (Tubgcp3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     259279 (Tubgcp3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   259279 (Tubgcp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCP_C_terminal GCP_N_terminal
Motif
Other DBs
NCBI-GeneID: 259279
NCBI-ProteinID: NP_932148
MGI: 2183752
Ensembl: ENSMUSG00000000759
Vega: OTTMUSG00000036064
UniProt: P58854
Position
8; 8 A1.1
AA seq 905 aa AA seqDB search
MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQFAVRVIGSNFAPTVERDEFLVAEKIKK
ELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLNLSEDPRKQASKVTSYASLFAQ
ALPRDAHSTPYYYARPQTLPLNYQDRSTQAQSSGSLGSSGISSIGMCGLSGPTPVQPFLP
GQSHQAPGVGDGLRQQLGPRLAWTLTGNQPSSQTPTSKGFPNALSRNLTRSRREGDPGGT
LEVTEAALVRDILYVFQGIDGKNIKMSSTENCYKVEAKANLNKSLRDTAVRLAELGWLHN
KIRKYADQRSLDRSFGLVGQSFCAALHQELKEYYRLLSVLHSQLQLEDDQGVNLGLESSL
TLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMKSLVQHILSLV
SHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFITMDQSRK
VLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPRDAADLFTDLENAFQGKIDAAYFETS
KYLLDVLNKKYSLLEHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILE
TAVRATNAQFDSPEILKRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLR
VFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYI
TFEVLECSWDELWNRVQQAQDLDHIIAAHEAFLNTITSRCLLDSNSRVLLNQLRAVFDQI
IELQNAQDVMYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIREFQDSIPK
MCSQLRILTHFYQGVVQQFLVLLTTSSDESLQFLSFRLDFNEHYKAREPRLRVSLGSRGR
RSSHT
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccggatcagaagtcgcccaacgttctgctgcagaacctgtgctgccggatc
ctgggccggagcgaagctgatgtggcccagcagttccagtttgctgtgagagttatcggc
agcaacttcgctccaactgttgaacgagatgaatttctagtagctgaaaaaatcaagaaa
gaacttattcgacaaaggagagaagcggacgccgcactgttttcagagctccacaggaag
cttcattcgcagggagttttgaagaataaatggtcaatcctctacctcctgctgaacctt
agtgaggaccctcgcaagcaggccagcaaggtgaccagctacgcttccttatttgcacaa
gcgttaccaagagacgctcactcgacgccttactactatgccaggcctcagaccctcccg
ctcaactaccaggaccgcagcacacaggcacagagctctggcagcctgggcagcagcggc
atcagcagcatcggcatgtgtggccttagtggccccacacctgtgcagcctttccttccc
ggacagtctcatcaagctccaggagtgggtgacggcctgcgacagcagttggggcctcgt
ctggcgtggactctgactggaaatcagccttcttcacaaacccctacctccaagggtttc
ccaaatgctctttctcgaaacctgacaaggtcaaggagagaaggggatccaggtggcaca
ttggaagttactgaagctgctcttgtgagagatattctctacgtattccagggcattgat
ggcaaaaacatcaaaatgagcagcactgaaaactgttacaaagtggaagcgaaggcaaac
ttaaacaaatctttgagggacacagcagtccggcttgctgagttgggatggttgcataat
aaaatcagaaagtatgctgaccagaggagtctggaccgctcatttggacttgtaggtcag
agtttttgtgccgcattgcaccaagagctcaaagaatactacaggctcctctctgttctg
cactctcagctccagctagaagatgatcagggtgtgaatttgggactagagagtagcctc
acactgcggcgcctcctggtttggacatatgaccccaaaataagattaaagacccttgct
gcgctggtagatcactgccaaggacgaaaagggggtgagctggcctctgctgttcatgcc
tatacaaagacaggggacccctacatgaagtccctggtgcagcacattctgagcttggtg
tctcaccctgtcctgagcttcctctaccggtggatatatgatggggagttggaggacact
taccacgaattttttgtggcgtctgatccaacagttaaaactgaccgtctatggcacgac
aagtataccctgaggaagtcaatgatcccctccttcattacgatggaccagtctaggaag
gtccttttgataggaaagtcaataaatttcttgcaccaagtttgtcatgatcagacacct
actacaaaaatgatagcagtgacgaagtcggcagagtcaccccgtgacgctgcggattta
ttcacagacttagaaaacgcatttcaagggaaaattgatgctgcttattttgagaccagc
aaatatctgttggatgtcctcaataaaaagtacagtctgctggaacacatgcaggccatg
cgacggtacctgctgcttggccaaggagacttcatacggcacttaatggatttgctcaaa
ccagaacttgttcggccagcaacaactttgtatcagcataacttgacggggattcttgaa
actgctgtgagagccaccaatgctcagtttgacagcccggagatccttaagaggctcgat
gtgaggctgctggaggtctctcctggtgacactgggtgggatgtcttcagcctggattac
cacgtcgatggaccaatcgccactgtgttcacacgagagtgcatgagccactacctgaga
gtgtttaacttcctgtggagggccaagcgcatggagtacatcctcactgacatccggaaa
gggcacatgtgcaacgcgaagctgctgaggaacatgccggagttctctggggtgcttcac
cagtgccacatcctggcctcagagatggtgcacttcatccaccagatgcagtactacatc
acctttgaggttctcgagtgctcctgggatgagctgtggaacagagtgcagcaggcccag
gacctggaccacattattgcagcacacgaggcgttcctgaacaccatcacctcccgctgt
ctcctggatagcaactccagggtgcttttaaaccaactgagagccgtgtttgaccaaatc
attgaacttcagaatgcccaggacgtgatgtacagagcagctctggaggagctgcagagg
cgtctgcagtttgaagagaaaaagaaacagcgtgaaattgagggccagtggggagtgact
gcggcagaggaagaggaggagaacaagaggatccgagaattccaggactccataccaaaa
atgtgctcacagttgcgaatattgacgcacttctaccagggtgtggtgcagcagtttctg
gtgttactcacgaccagctctgatgaaagtctccagtttctcagcttcagattggacttc
aacgaacattacaaagccagagaacccaggctccgggtctctctgggcagtagggggcgg
cgcagttcccacacgtga

DBGET integrated database retrieval system