KEGG   Mus musculus (mouse): 260302Help
Entry
260302            CDS       T01002                                 

Gene name
Gga3, C230037M19Rik, mKIAA0154
Definition
(RefSeq) golgi associated, gamma adaptin ear containing, ARF binding protein 3
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    260302 (Gga3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    260302 (Gga3)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   GGA
    260302 (Gga3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHS Alpha_adaptinC2 GGA_N-GAT GAT DNA_ligase_A_N HBM DUF3891 SesA HD_2 DASH_Dad4
Motif
Other DBs
NCBI-GeneID: 260302
NCBI-ProteinID: NP_766636
MGI: 2384159
Ensembl: ENSMUSG00000020740
Vega: OTTMUSG00000003472
UniProt: Q8BMI3
Position
11; 11 E2
AA seq 718 aa AA seqDB search
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EAVQALTVLEACMKNCGRRLHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLFS
WTLALPEEAKIKDAYHMLKRQGIVQSDPPIPMDRTLIPSPPPRPKNPVFDDEEKSKLLAR
LLKSKNPDDLQEANRLIKSMVKEDEARIQKVTKRLHTLEEVNNNVKLLHEMLLHYSQEYS
SDADKELMKELFDRCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
IVNGEVTTSTMPDSEGNSHCGNQGALIDLAELDAPSNSSPALAPPTSGIPILPPPPQTSG
PPRSRSSSQAEAPPGSDSTNNALSLLDEELLCLGLTDPAPTAPKESPGSSQWHLFQNEPP
SDLDFFSPRPVPAASCPSDGPQLPPPVSTSSMSQAPLPAAFPAPVVPASAPTHSTGSFMF
SSGPAPALAPKAEPKGPEYPSSSTSHRLDALDQLLEEAKVTSGLVKPVSCFSPGPTASPL
LPASAPARPLLPFSTGPGSPLFQSQGSPQKGPELSLASVHVPLESIKPSSALPVTAYDKN
GFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELS
PFSPIQPPAAITQVMLLANPMKEKVRLRYKLTFALGEQLSTELGEVDQFPPVEQWGNL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggaaggggagagcctggagtcctggctgaataaagctaccaatccttcc
aaccgccaggaagactgggaatatatcattggtttctgtgatcagatcaacaaagagctt
gaagggccccagattgctgtgcgactcctggcccacaagatccagtctccacaggaatgg
gaggcagtgcaggccctcacggtgctggaggcgtgtatgaagaactgtggcaggagactt
cataatgaagtggggaagttccggtttttgaatgaattaatcaaagtcgtctctccaaag
tacttgggagacagggtgtctgaaaaggtgaagactaaggtcatcgagttgctttttagc
tggacactggccttgccggaagaagcaaagatcaaagatgcctaccatatgttgaagaga
caaggcatagtgcagtcggacccccccatccccatggatagaacgctgatcccctctccc
ccacctcggcccaaaaaccccgtttttgatgatgaggagaaatccaagcttttagccagg
ctgctgaagagcaagaacccagatgacctgcaagaggccaacagactcatcaagtccatg
gtgaaggaagatgaggctcgcatccagaaagtgaccaagcgtctacacacactggaggag
gttaacaacaatgtcaagctgctccacgagatgctgcttcactacagccaagagtactcg
tcagacgccgacaaggagctcatgaaggagctctttgatcgttgtgagaataagaggcgg
acgctgtttaaactagccagcgagacagaggacaatgacaacagtttgggggacatcctg
caggccagtgacaacctgtccagggtcatcaactcttacaaaactattattgaagggcag
atcgtcaatggtgaggtgaccacctcaaccatgcctgactctgaaggaaacagtcactgt
ggtaaccaaggcgccctcattgaccttgctgagttggacgcccccagcaactcgtctccg
gcattggccccacccacctcaggcatccccatcctccctccacccccccaaacctccggg
cctccacgaagccgttcatccagccaggctgaggctcccccagggtctgacagcacgaac
aatgccctctccttgctggatgaggagctcctctgcttaggccttactgaccccgccccc
actgctcccaaagagtcacctggaagtagtcagtggcacctgttccagaatgaaccacca
tcagatctggacttcttcagtcccaggccagtgcctgcggcctcctgcccctcagatgga
ccccagctccctcccccagtttctacctcaagtatgtcccaagctccactgcctgctgcc
ttcccagctcctgtggtcccagccagtgcaccaacccacagcactggctccttcatgttc
tcttctggacctgccccagccttggctccaaaggctgagcccaaaggtccagaatacccc
agctccagcacctcgcaccgcctagatgcccttgatcagcttctggaagaggccaaagta
acctcaggcttggtgaaacctgtttcttgcttctctcctgggcccactgcctccccgctg
ctgcctgcctctgccccagccagacctctcctgcccttctccactgggcccggaagccct
ctcttccagtcccaaggcagccctcagaaaggcccagagctctccttggccagtgtccat
gtgcccctggaatcgatcaagcctagcagtgcccttcccgtgacagcctatgataaaaat
ggcttccgcatccttttccactttgctaaggagtgtccgccaggacggcctgatgtgctg
gtggtggtggtttccatgctgaatacggctccgttgccagtcaagagcatagtgctgcag
gctgcagtgcccaagtcaatgaaagtgaagttgcagccaccctctgggacagaactttcc
ccatttagtcctatccagccacctgcagccatcacccaggtcatgctgctggccaatcca
atgaaggaaaaggtgcggcttcgatataaactgacctttgctttgggggagcagctgagc
acagaactgggtgaagtggaccagtttcctcctgtggagcagtgggggaacctatga

DBGET integrated database retrieval system