KEGG   Mus musculus (mouse): 263406
Entry
263406            CDS       T01002                                 

Symbol
Plekhg3, BC030417
Name
(RefSeq) pleckstrin homology domain containing, family G (with RhoGef domain) member 3
  KO
K23859  pleckstrin homology domain-containing family G member 1/2/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    263406 (Plekhg3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   263406 (Plekhg3)
SSDB
Motif
Pfam: RhoGEF PH PH_16 PH_10 PH_13
Other DBs
NCBI-GeneID: 263406
NCBI-ProteinID: NP_722499
MGI: 2388284
Ensembl: ENSMUSG00000052609
UniProt: Q4VAC9
Position
12; 12 C3
AA seq 1341 aa
MPVSTALHQDGSQERPRSLVSTTSSSGSSRDSHSAMEEPTGSEASAQNGTGSPWDRHVPN
SNNNSSGWLNMKGPLSPFNGRAGTSPAYHKLSYLGRVVREIVETERMYVQDLRSIVEDYL
LKIIDTPGLLKPEQVSALFGNIESIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIY
TQYCNNYPNSVAALTECMQDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRVLKYHLLLQE
IAKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTY
GELVLEATFRVHRVRNDRTFFLFDKILLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCF
TVTHYKHSKQQYSIQAKTVEEKRSWTHHIKRLILENHHATIPQKAKEAILEMDSYYPSRY
RCSPERMKKAWSSQDEVSSHVRQGRRQSEPGHTLFSRATLPSRQQGFEMPGLKGRRKSEP
TRHLLRQLSEKARAVGMKHAGSAGALLDFGQPAHAQKQQPEAERAAREELEEEEELVEEE
EQRQQSFSGSLEGLAGHDGSEKVPGPELPGSEEEEEEEESLAVAEQGKRHRESEGSKGCR
RPSNRSPTSAEKRMSFESVSSLPEVETDPEPGAEQEAFAALEGPSTEEMPSDPEFPEALE
TQLHAPKGLLGVDNPAAVVDFVEPEGSEDLKPLSSEEEEEEEMEAAQEPESLLPPSVLDQ
ASVIAERFASSFSRRSSLAIEDGKSSGLGTPRLISRSSSVLSLEGSDKGLARWSSIGDSL
SNPPTPEVIIGADMVTDNGPSVNGTESPSAGSGCPTEQDRSSCKKKESALSTRDRQLLDK
IKNYYENAEHHDAGFSIRRRESLSYIPKGLVRSSVSRFNSLPKPDSEPAAPVGYKRPGSS
RPASWTLFDLPGPRTDKGDPAPITDAEFCPSSEIAKIWERMESSERSPRTGSGQSQANGF
ELQEPLFILEEHELGAITEESAVASPESASPTEQPSPAHLARELKELVKELSSSVQGELV
TPLHPRIVQLSHVMDSHVSERVKNKVYQLARQYSLRIKNIKAARPPLQWEKVTPDQEEQV
PSISGLPEEAGELSGGKARRKPVLSLLSYEQLVAQEHGTSKSSAAVETSPRRFSFSPSAV
SPRTTSPGARSSARSPLSPFDTETFNWPDVRELCSKYTSHDKTAQVESSWPRSLLVNRSR
SLPENIVEPPMSGKADRCCGLNTHRRLGDGEASQPPLPESPPQSQLNGGDALYVTADLTL
ENNQRVIIMEKGPHPSSTVGLEEDSGKESSSPVALKGQGQGFQASAEYQPKEHGPRDSAD
TNKQGRVRNLREKFQALNSVG
NT seq 4026 nt   +upstreamnt  +downstreamnt
atgcccgtctccactgccctccaccaagatggcagccaggagcggccacgaagcctagtg
tccaccacttcttcatctggctcctcccgtgacagtcacagtgccatggaggagcccact
ggctcggaggcttcagcccagaatgggacaggctccccttgggaccggcatgttcccaac
agcaacaacaactccagtggctggctgaacatgaagggacctctctccccattcaacggc
cgtgcagggacaagtcctgcctaccacaagctcagctatctgggccgggtggtgagagag
atcgtggaaacagagcgcatgtatgtgcaggacctacggagcattgtggaggactacctc
ttgaagatcattgacactccaggactcctgaagccagagcaagtcagcgccctctttggg
aacatagagagcatatatgcactgaacagccagcttctcagagacctggacagctgcaat
agtgaccctgtggcagtggccagctgcttcgtggaaaggagccaagagtttgatatatac
actcagtattgcaacaactaccccaactcagtggcagccctcacagagtgcatgcaagac
aagcaacaagctaagttcttcagagatcggcaggagctgctgcagcactccctgcctctg
ggctcctacctgctgaagccggtccagcgcgtcctgaagtaccacctgctgctccaggaa
attgccaaacattttgatgaggaagaggatggcttcgaggtggtggaggatgccatcgac
accatgacgtgcgtggcctggtacatcaacgacatgaagaggaggcatgagcacgcagtt
cggctacaggagatccagtcactgctcattaactggaagggaccggacctgaccacttac
ggggagctggtcctggaagccacctttcgtgtgcaccgcgtgcgcaatgacagaactttc
ttcctctttgacaagatactgctcattaccaagaagcgaggcgaccactttgtctacaag
ggccacattccgtgctcctcactgatgctgatcgaaagcaccagagactctctctgcttc
actgtcacccactataagcacagcaaacaacaatacagtatccaggccaagaccgtggag
gagaaacggagctggactcaccacatcaagaggctcatcttggagaaccaccatgccacc
ataccccagaaggccaaggaagccatcttggaaatggactcctattatcccagtcggtat
cgctgcagcccagagcggatgaaaaaggcctggtcctcccaggatgaggtgtctagccac
gtgcgccaaggacgtcggcagtctgagcctggtcataccctgttcagcagggcaacactc
cccagcaggcagcaaggattcgagatgccaggccttaagggccgtagaaagtcggagccc
accagacacctgctcaggcaactgagtgagaaagccagagcagtgggaatgaagcatgca
ggcagtgctggagccctcttggactttgggcagccagcccatgcacagaagcagcagcca
gaggctgagagggccgccagggaagagcttgaggaagaggaggagctggtggaggaggaa
gaacagcggcagcagagcttctcgggctccctggagggccttgcagggcatgatggcagc
gagaaggtgcctgggccagagctcccgggctcggaggaggaggaggaggaagaagagagt
ctagcagtggcggagcaggggaagagacacagggagtctgaaggctctaaaggctgcaga
aggcccagtaaccggtcgccaaccagtgcggagaagcgcatgagctttgagtctgtttct
tccctgccagaggttgagacagatcctgagcctggggccgagcaggaggcctttgcggcc
ttggaaggtcccagcacagaggagatgccttcagacccagaatttccagaagccctggag
acacagcttcatgcccccaaggggctgctaggagtggacaacccagctgctgtggtggac
tttgtggagcctgaggggtctgaagaccttaagcccctgagtagtgaggaggaagaagaa
gaggaaatggaagccgcccaggagcctgagagcctcctgccaccctctgtgctggaccag
gccagtgtcattgctgagagattcgccagtagcttctctcggcggagcagcctggcaata
gaggatggcaaatccagtggtttagggacaccacggcttatcagccggagcagcagtgtg
cttagcctggagggcagtgataagggcctagcccgatggagcagcatcggggactccctc
agcaacccacccaccccagaagtgatcattggtgcagacatggtcacagacaatggccct
tctgtcaatgggacagaatctccaagtgcaggctcaggctgccccacggaacaggacaga
tcttcctgtaagaaaaaagaatcagcgttgtctacccgagaccgtcagctgctggacaaa
attaagaactactatgaaaatgcagagcaccatgatgctggcttcagcatccgtcggcgg
gagagcctctcctatatccctaaaggattggtgcgcagctctgtgtccagattcaacagc
cttcccaagccagattcagagccagcagctccagttgggtacaagaggccggggagttct
cgtccagcctcatggaccttgtttgaccttccaggtcccaggacagacaaaggggaccca
gctcctatcacagatgctgagttctgtccatcttcagaaattgcaaagatatgggaaaga
atggagtcttcagagagaagtccacggacagggtctggccagagccaggccaatggcttt
gagctacaagagccactgttcatcttggaggagcatgaactgggggccatcactgaggag
tctgctgtcgcctctccagaaagtgcctcccccaccgagcaacccagcccagcccacctg
gcccgggagctcaaagagctggtgaaagagctgagcagcagtgtccagggggagctggtt
accccactgcacccccggattgtgcagctctcccatgtgatggacagccatgtgagtgag
cgggtcaaaaacaaggtctaccagttggcccgccagtacagcctccgaattaagaacatc
aaggcagctaggccacctctacagtgggaaaaagtcactcctgaccaagaggagcaggtc
ccttccatttctggcctgcctgaggaagctggagagctgtcagggggcaaagccaggagg
aagcctgtgctatccctcctcagctatgagcagctggtggctcaggagcatggcacgtcc
aagtcttccgctgccgtggaaacctctccacgccgtttctccttcagcccttctgctgtt
agcccaagaaccacctcacctggggctcggtcctctgctcggagccccctcagccccttt
gacaccgagaccttcaattggcctgatgtccgggagctctgctccaaatatacttcccac
gacaagactgctcaggtcgagagcagctggccccgtagcctgctggtcaacaggagtcgc
tccctgcccgagaacatcgtagaacctcccatgtctggcaaggcggaccgctgctgtggc
ctgaacacccacaggcgcctgggagatggggaagcctcccagcctccacttcctgagtct
cctccccaaagccagctgaatggaggcgacgccctgtatgtcaccgcagaccttaccctg
gagaacaaccagcgagtgatcattatggagaaggggccccatcctagctccaccgtgggg
ctggaggaagacagtgggaaggaatcaagttccccagtggctttgaagggacagggccaa
ggtttccaggcgtctgcagagtaccagcccaaagaacacggtcccagggactcagcagac
acaaacaaacagggtagagtgagaaacctgagggagaagttccaggccttgaactctgtg
ggttga

DBGET integrated database retrieval system