KEGG   Mus musculus (house mouse): 26357
Entry
26357             CDS       T01002                                 
Symbol
Abcg2, ABC15, ABCP, AI428558, BCRP, Bcrp1, MXR, MXR1
Name
(RefSeq) ATP binding cassette subfamily G member 2 (Junior blood group)
  KO
K05681  ATP-binding cassette, subfamily G (WHITE), member 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01523  Antifolate resistance
mmu02010  ABC transporters
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    26357 (Abcg2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    26357 (Abcg2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    26357 (Abcg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    26357 (Abcg2)
   04147 Exosome [BR:mmu04147]
    26357 (Abcg2)
   04090 CD molecules [BR:mmu04090]
    26357 (Abcg2)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    26357 (Abcg2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   26357 (Abcg2)
CD molecules [BR:mmu04090]
 Proteins
  26357 (Abcg2)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_7 AAA_21 SMC_N AAA_23 RsgA_GTPase AAA_29 ABC2_membrane_3 Adeno_IVa2
Other DBs
NCBI-GeneID: 26357
NCBI-ProteinID: NP_036050
MGI: 1347061
Ensembl: ENSMUSG00000029802
Vega: OTTMUSG00000022209
UniProt: Q7TMS5 A0A0R4J0B6
Position
6:58561476..58669436
AA seq 657 aa
MSSSNDHVLVPMSQRNNNGLPRMNSRAVRTLAEGDVLSFHHITYRVKVKSGFLVRKTVEK
EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPKGLSGDVLINGAPQPAHFKCCS
GYVVQDDVVMGTLTVRENLQFSAALRLPTTMKNHEKNERINTIIKELGLEKVADSKVGTQ
FIRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS
IHQPRYSIFKLFDSLTLLASGKLVFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD
SSAVMLNREEQDNEANKTEEPSKGEKPVIENLSEFYINSAIYGETKAELDQLPGAQEKKG
TSAFKEPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGAIYFDLKYDA
AGMQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKVMSDLLP
MRFLPSVIFTCILYFMLGLKKTVDAFFIMMFTLIMVAYTASSMALAIATGQSVVSVATLL
MTIAFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQYNEFLGQEFCPGFNVTDN
STCVNSYAICTGNEYLINQGIELSPWGLWKNHVALACMIIIFLTIAYLKLLFLKKYS
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgtcttccagtaatgaccacgtgttagtaccaatgtcgcagagaaacaacaacggcctt
cctaggatgaactccagagccgttaggacgctcgcagaaggagatgtgttgagttttcat
cacatcacctatcgagtgaaagtaaagagtgggtttctagtccggaaaacagttgagaaa
gaaatactatcagatatcaatgggatcatgaaacctggccttaatgctattctgggaccc
acaggcggaggcaagtcttcgttgctagatgtcttagcagcaaggaaagatccaaaggga
ttatctggagatgttttgataaatggagcacctcaacctgcccatttcaaatgctgttca
ggttatgtggttcaagatgacgttgtgatgggcaccctgacagtgagagaaaacttacag
ttctcagcagctcttcgacttccaacaactatgaagaatcatgaaaaaaatgaacggatt
aacacaatcattaaagagttaggtctggaaaaagtagcagattctaaggtcggaactcag
tttatccgtggcatctctggaggagaaagaaaaaggacaagcatagggatggagctgatc
actgacccttccatcctcttcctggatgagcccacgactggtttggactcaagcacagcg
aatgctgtccttttgctcctgaaaaggatgtctaaacagggtcgaacaatcatcttctcc
attcatcagcctcggtattccatctttaagttgtttgacagcctcaccttactggcttcc
gggaaactcgtgttccatgggccagcacagaaggccttggagtactttgcatcagcaggt
taccactgtgagccctacaacaaccctgcggattttttccttgatgtcatcaatggagat
tcttctgctgtgatgttaaatagagaggaacaagacaatgaagcaaacaagactgaagag
ccttccaagggagagaagccagtaatagaaaatttatctgagttttatatcaactctgcc
atctatggagaaacaaaagctgaattagatcaacttccaggagctcaggaaaagaaagga
acatcggccttcaaagagccagtctatgttacctctttctgtcaccagctccgatggatt
gccaggcgctcatttaaaaacttgctcgggaaccctcaagcttctgttgctcagttaatt
gttacagtcatactggggcttattattggtgccatttactttgatctgaaatatgatgcc
gctggaatgcaaaatagagctggagttttgtttttcctgactaccaaccagtgtttttcc
agtgtgtcagctgtggagctgttcgtagtggagaagaaactcttcatacatgagtacatc
agtggatattacagagtgtcttcttacttctttggaaaggtgatgtctgatttactcccc
atgaggttcttgccaagtgttatattcacttgtatattatacttcatgttaggactgaag
aagacggtggatgcttttttcatcatgatgtttacccttataatggtggcttatacggcc
agttccatggcactggccatagccacaggccaaagtgtggtgtctgtagcaacacttctc
atgacaatcgcttttgtatttatgatgctcttttctggcctcttggtgaatctcagaacc
attgggccttggctgtcctggcttcagtactttagcattcctcgatatggcttcacagct
ttgcagtataatgaattcttgggacaagagttttgtccaggattcaatgtaacggacaac
agcacttgtgttaacagctatgcaatatgtactggtaacgagtacttgataaatcagggc
atcgaactgtcaccttggggactgtggaagaatcatgtggccctggcttgtatgattatt
atcttcctcacaattgcctacctgaaattgttgtttcttaaaaagtattcttaa

DBGET integrated database retrieval system