KEGG   Mus musculus (mouse): 26368Help
Entry
26368             CDS       T01002                                 

Gene name
Ceacam9, AA410097, AW545709, Cea-5, Cea5, mmCGM8
Definition
(RefSeq) carcinoembryonic antigen-related cell adhesion molecule 9
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    26368 (Ceacam9)
   04090 CD molecules [BR:mmu04090]
    26368 (Ceacam9)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    26368 (Ceacam9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   26368 (Ceacam9)
  Exosomal proteins of bladder cancer cells
   26368 (Ceacam9)
CD molecules [BR:mmu04090]
 Proteins
  26368 (Ceacam9)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  26368 (Ceacam9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 Receptor_2B4 Ig_6 Ig_4 Ig_5 Izumo-Ig Herpes_gE
Motif
Other DBs
NCBI-GeneID: 26368
NCBI-ProteinID: NP_036057
MGI: 1347247
Ensembl: ENSMUSG00000007209
Vega: OTTMUSG00000058017
UniProt: Q78T27
Position
7 A2; 7 9.15 cM
AA seq 234 aa AA seqDB search
MGAETMESPSLFLCKGLLLTAFLLTCWNAPAAAELTIELVPPMVAEGGNSVLFVHEMPLN
VQAFYWYKQRDSTKSYEVARYLTPTNQSSKMPQHSDRKTVFYSGSLLIRNVTKADSGVYT
LLTFNTEMESELTHVHLEVQEPVAQPTLQADSTAVTEAGSVTLTCVSEDPGLSIRWLFNH
QGLYFNDRMTLSQKNSRLTIDPAKREDAGEYQCEVSNGYSSKMSLPLQMSVTSE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagagaccatggagtccccttctctgtttctctgcaaagggctcctgctcaca
gccttcctcttaacctgctggaatgcacccgccgctgccgagctcactattgaattagtg
ccacccatggttgccgaaggcggaaactccgttctgtttgtgcatgaaatgccactgaac
gtccaggcgttttactggtacaaacagagagattcgacgaagagctacgaagtcgcacgg
tacttaacacccacgaaccaaagttcgaagatgcctcagcacagtgataggaaaaccgta
ttctacagtggatccctgctgatcagaaacgtcaccaaggctgacagtggagtctatacc
ttactaacatttaacacggaaatggaaagcgaattaacacatgtgcatctggaagtgcag
gagcccgtggcacagcctaccctccaagcagacagcaccgcggtaacagaagctggttct
gtgaccctcacatgtgtctcagaagaccctggactctccatccgctggctcttcaatcac
cagggcctgtatttcaatgacaggatgactctgtcccagaaaaacagcagacttaccata
gacccagccaagagggaggatgctggggagtaccagtgcgaggtctccaacggctacagc
tctaagatgagtctcccgctccaaatgtctgtgactagtgagtga

DBGET integrated database retrieval system