KEGG   Mus musculus (mouse): 26372
Entry
26372             CDS       T01002                                 

Gene name
Clcn6, AI850629, Clc6
Definition
(RefSeq) chloride channel, voltage-sensitive 6
  KO
K05015  chloride channel 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    26372 (Clcn6)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel (CLC)
   26372 (Clcn6)
SSDB
Motif
Pfam: Voltage_CLC CBS DUF2140
Other DBs
NCBI-GeneID: 26372
NCBI-ProteinID: NP_036059
MGI: 1347049
Ensembl: ENSMUSG00000029016
Vega: OTTMUSG00000010195
UniProt: O35454 Q3UM91
Position
4 E1; 4 78.67 cM
AA seq 870 aa
MAGCRGSVCCCCRWCCCCGERESRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDP
YLEVLETMDNKKGRRYEAVKWMVVFAIGVCTGLVGLFVDFSVRLFTQLKFGVVQTSVEEC
SQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEIKCYLNGVKVPGIVRLRTL
LCKVFGVLFSVSGGLFVGKEGPMIHSGAVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRD
FVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF
GSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNCLNKRLAK
YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSTSQTGNGSFQLQVTSE
DVNSTIKAFFCPNDTYNDMATLFFNSQESAILQLFHQDGTFSPVTLALFFILYFLLACWT
FGTSVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHLYSGTFALIGAAAFLGGVVRMTIS
LTVILIESTNEITYGLPIMVTLMVAKWTGDLFNKGIYDVHIGLRGVPLLEWETDVEMDKL
RASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKF
KKSSILTRAGEQRKRGQSMKSYPSSELRNVCDEHVASEEPAEKEDLLQQMLERRYTPYPN
LYPDQSPSEDWTMEERFRPLTFHGLVLRSQLVTLLVRGVCYSESQSSASQPRLSYAEMAE
DYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVN
AVGEIVGIITRHNLTNEFLQARLRQHYQTL
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggcggggtgcagggggtccgtgtgctgctgctgccggtggtgttgctgctgcggtgaa
cgggagagccgcacccccgaggagctgaccatccttggggagacacaggaagaagaggat
gagattcttccaaggaaagactatgagagtctggactatgaccgctgcatcaatgaccct
tacctggaggtgttggagaccatggataataagaaagggcgaagatacgaggcggtgaag
tggatggtggtgttcgccattggcgtctgtacggggctggtgggtctctttgtggacttt
tccgtgcgactcttcacccaactgaagttcggagtggttcaaacgtcggtggaggaatgc
agtcagaagggctgccttgccctgtccctcctggagctcctgggctttaacttgaccttt
gtcttcctggcaagccttcttgtcttgatagagccagtggcagcaggttctggaatcccc
gagatcaagtgctacctgaatggtgtgaaagtgccaggaattgtccggctccggaccctg
ctctgcaaagtctttggggtgctgttcagtgtgtctggagggctctttgtggggaaagaa
ggccccatgatccacagtggtgctgtggtaggagctggcctccctcagttccagagcatc
tccttacggaagatccagtttaacttcccctacttccgcagcgacagagacaagcgtgac
tttgtgtcagcgggggcagctgctggcgttgctgcagcttttggggcccctatagggggc
accttgttcagtctggaggagggttcatccttctggaaccaggggctcacgtggaaagtg
ctcttctgttccatgtccgccaccttcaccctcaacttcttccgctctgggattcagttt
ggaagttggggttccttccagctgcctggattgctgaactttggtgaatttaagtgctct
gactctgataaaaaatgtcatctctggacagctatggatttgggtttcttcgtcgtgatg
ggggtcattgggggcctcctgggagccacattcaactgtctgaacaagaggcttgcaaag
taccgtatgcgcaacgtgcacccgaaacctaagctcgtcagagtcttagagagcctcttg
gtgtccctggtgaccactgtggtggtgtttgtggcctccatggtgttaggagaatgccga
cagatgtcttccacgagtcaaaccggtaatggctcattccagctccaggtcacatcagaa
gatgtgaattcaactatcaaggcttttttctgtcccaatgacacttacaatgacatggcc
acactcttcttcaactcccaggagtctgccatcctgcagctcttccatcaggatgggact
ttcagccccgtcaccctggccttattcttcatcctctatttcctgctcgcatgctggact
tttggcacatctgtccccagtggcctcttcgtgccttccctgctgtgtggagcagctttt
ggacgtttagttgccaatgtcctgaaaagctacattggactgggccacctctattctggg
acctttgccctgattggtgcggcagctttcttgggtggggttgtaaggatgaccatcagc
ctcacagtcatcctgatcgagtctacaaatgagatcacctatgggcttccgatcatggtc
actctgatggtggccaagtggactggagacttgttcaacaagggcatttatgacgtccat
attgggctgagaggtgtgcctcttctggagtgggagacagacgtggaaatggacaagctg
agagccagtgacatcatggagcccaacctgacgtacgtctacccgcacactcgcatccag
tctctggtgagcatcctgcgcactacggtccaccatgccttcccagtggtcacggagaac
cggggcaacgagaaggagttcatgaagggcaaccagctcataagcaacaacatcaagttc
aagaaatccagtatcctgacccgtgctggtgagcagcgcaagcggggccagtccatgaag
tcgtacccttccagcgagctgcgcaacgtgtgtgatgagcatgtggcttctgaggagccg
gcagagaaggaggacctgctacagcagatgctggagaggagatacactccctaccccaac
ctataccctgaccagtccccgagtgaagactggaccatggaggagcgtttccgtccgctg
acctttcacggccttgtcctgcgctctcagcttgtcaccctgcttgtccgaggagtgtgc
tattcggaaagtcagtccagtgccagccaaccacgtctttcttacgctgagatggctgag
gactacccgcgatacccggacatacatgacctggacctcacactgctgaatccccgaatg
attgtggatgtcaccccatatatgaatccttcaccatttaccgtctcccccaacacccat
gtttctcaagtgttcaacctgttcagaaccatgggcctgcgccacttgcctgtggtgaat
gcagtaggagagatcgtggggatcattacacggcacaacctgacaaatgaattcctgcag
gcccggctgcggcagcattaccagaccctctga

DBGET integrated database retrieval system