KEGG   Mus musculus (mouse): 26374
Entry
26374             CDS       T01002                                 

Gene name
Cop1, AI316802, C80879, Co, Rfwd, Rfwd2
Definition
(RefSeq) COP1, E3 ubiquitin ligase
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04115  p53 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26374 (Cop1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    26374 (Cop1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26374 (Cop1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     26374 (Cop1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    26374 (Cop1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     26374 (Cop1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 Prok-RING_4 zf-RING_10 zf_C2H2_10 zf-RING_4 zf-RING_11 DZR zf-Nse
Other DBs
NCBI-GeneID: 26374
NCBI-ProteinID: NP_036061
MGI: 1347046
Ensembl: ENSMUSG00000040782
Vega: OTTMUSG00000050285
UniProt: Q9R1A8
Position
1; 1 H1
AA seq 733 aa
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAASAATLVSGGVAPAAGSGG
LGGPGRPVLVAAAVSGSASAGGAVSAGQSRLSCAARPSAGVGGSSSSLGSSSRKRPLLVP
LCNGLLNSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVD
NIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDLLGTDQDNLDLANV
NLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEE
MSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGTSQTKKQPWYNSTLASRRK
RLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLY
NGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTCNSKISCISW
SSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKV
KLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGH
RKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACG
SENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALSDGESNVLIA
ANSQGTIKVLELV
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgtcaggtagccgccaggccggctcgggttccgctgggacgagccccggctcctcggcc
gcctcctcggtgacttccgcctcctcgtccttatcctcgtctccgtcgccgccgtccgtg
gcggcctcggcggcgacgctggtgtccggcggcgtggctccggccgcgggctccggcggc
ctcggcggcccggggcggcctgtgctggtggcggccgcggtgtctggcagcgcgagcgcc
ggcggggcggtgtccgcgggccagtcccggctcagctgcgcggccaggcccagcgccggc
gttggagggagcagctccagcctcggcagtagcagtaggaagcgacctctgctcgtcccg
ctttgtaacgggctcctcaactcctacgaggacaaaagcaacgacttcgtctgtcccatc
tgctttgatatgattgaggaggcatacatgacaaaatgtggccacagcttttgctacaag
tgtattcatcagagtttggaggacaataatagatgtcccaagtgtaattatgttgtggac
aatattgaccatctctatcctaatttcttggtgaatgaactcattctcaaacagaagcaa
agatttgaggaaaagaggttcaaattggaccactcagtgagtagcaccaatgggcatagg
tggcaaatatttcaagatctactaggaactgatcaagataaccttgatttggccaatgtc
aacctcatgttggaattattagtgcagaagaagaaacaactggaagcagaatcacatgca
gctcagctacagatccttatggaattcctcaaggttgcaaggagaaataagagagagcaa
ttggagcagatccagaaggaactaagtgttttggaagaggatattaaaagagtggaagaa
atgagtggcctctactctcctgtcagtgaagatagcacagtgcctcaatttgaagctcct
tctccatcacacagtagcattattgattctacagaatacagccaacctccaggtttcagt
gggacctctcagacaaagaaacagccttggtataacagcacattagcatcaagacgaaag
cgactcactgctcattttgaagacttagagcagtgttatttttctacaaggatgtctcgt
atctcagatgacagtagaactgcaagccagttagatgaatttcaagaatgcttgtccaag
tttactcgatacaactcagtaagaccgttggccacattgtcttatgctagtgatctctat
aatggttccagcatagtttctagtattgagtttgaccgggattgtgactattttgcaatt
gctggagttacaaagaagattaaagtctatgagtatggcacagtcatccaggatgcagtg
gatattcattaccctgagaatgaaatgacctgcaattccaaaatcagctgtatcagttgg
agtagttaccataagaacctgctagccagcagtgattatgaaggcactgttatactatgg
gatggattcacaggacagaggtcaaaggtctatcaggagcatgaaaaaaggtgttggagt
gttgactttaatctgatggatcctaaacttctggcttcaggttctgatgatgcaaaagtg
aagctgtggtctaccaatttagacaattctgtggcgagcattgaggcaaaggctaacgtg
tgctgtgtgaagttcagcccctcctccaggtaccatctggctttcggctgtgcagatcac
tgtgtccactactacgaccttcgtaacactaaacagccaataatggtattcaagggacac
cgaaaagcagtgtcttatgccaagtttgtaagtggtgaagaaattgtctcagcctcaaca
gacagccaactaaagctgtggaatgtgggaaaaccatactgtctacgttccttcaagggt
catattaatgaaaaaaactttgtaggccttgcttccaatggagattatatagcgtgtgga
agtgagaacaactccctctacctgtattataaaggactttctaaaactttgctaactttt
aagtttgataccgttaagagtgtattagacaaagatcggaaagaagatgacacaaatgaa
tttgtcagtgctgtgtgttggcgggcactatcagacggggagtccaatgtgctgattgct
gctaacagccagggtacaattaaggtgctagaattggtataa

DBGET integrated database retrieval system