KEGG   Mus musculus (mouse): 26378
Entry
26378             CDS       T01002                                 

Gene name
Decr2
Definition
(RefSeq) 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal
  KO
K13237  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], peroxisomal [EC:1.3.1.124]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    26378 (Decr2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.124  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
     26378 (Decr2)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR F420_oxidored DUF4675
Other DBs
NCBI-GeneID: 26378
NCBI-ProteinID: NP_036063
MGI: 1347059
Ensembl: ENSMUSG00000036775
Vega: OTTMUSG00000021323
UniProt: Q9WV68 Q3UVJ7
Position
17 A3.3; 17 13.06 cM
AA seq 292 aa
MAQPPPDVEGDDCLPEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGR
SLQKVTTAAKKLVAATGKRCLPLSMDVRVPPEVMTAVDQALQEFGKINILINCAAGNFLC
PASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNITATLSMRGQVLQLHAGA
AKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLRGSNASSKLKHFSNPIPRLG
TKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLEFESFSAKL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcccagccgccgcccgacgttgagggggatgactgtcttcctgaataccaccatctc
ttctgcccggatcttctccaggacaaagtggcctttatcacaggtggtggttctgggatt
ggcttccggatcgcagagattttcatgaggcatggctgccacactgtcatcgtcggcagg
agtctgcagaaagtgaccacggctgctaagaagttggttgctgccaccggaaagcggtgc
ctccctctgtctatggatgtccgagttcccccagaggtcatgactgctgtggatcaagcg
ctgcaagaatttggcaaaatcaacatcctcattaactgtgcagctggaaacttcctatgc
cctgccagtgctttgtctttcaatgcctttaagaccgtggttgacattgacaccatcggt
accttcaatgtgtctagtgtgctttacaagaagttcttccgggaccatggaggagtgatt
gtgaacattactgccaccctcagtatgagggggcaggtgctacagctacatgcaggcgct
gccaaagcagctgtggatgctatgacgcgacacttggctgtggaatggggtccccagaat
atccgtgtcaacagcctggctcctggtgccatcagtggcactgagggtttaaggcgatta
agaggctccaatgccagttcgaaattaaagcatttttcaaatcctattccaagacttggg
accaagacagagatcgctcacagcgtgctgtacctggccagccctctggcttcctatgtc
tcaggtatcgtgctggtggttgatggtggaagctggatgacattccccaatggcatcaag
caactgctagagtttgaatccttctctgctaagctgtag

DBGET integrated database retrieval system