KEGG   Mus musculus (house mouse): 26380
Entry
26380             CDS       T01002                                 
Symbol
Esrrb, Err2, Errb, Estrrb, Nr3b2
Name
(RefSeq) estrogen related receptor, beta
  KO
K08553  estrogen-related receptor beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    26380 (Esrrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    26380 (Esrrb)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    26380 (Esrrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    26380 (Esrrb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    26380 (Esrrb)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    26380 (Esrrb)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   26380 (Esrrb)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 26380
NCBI-ProteinID: NP_001152972
MGI: 1346832
Ensembl: ENSMUSG00000021255
UniProt: Q61539 E9QKA2 Q80VS1
Position
12:86407891..86568402
AA seq 438 aa
MLLNRMSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGIALSTHANG
LDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHY
GVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRL
DRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLYAMPPNDIPEG
DIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSAWMEILILGIVYRSLPY
DDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKEEFMILKALALANSDSM
YIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKL
QGKVPMHKLFLEMLEAKV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgctgctgaaccgaatgtcgtccgaagacaggcacctgggctctagttgcggctccttc
atcaagacggagccatccagcccgtcctcgggcattgatgccctcagccaccacagcccc
agcggctcgtcggacgccagtggtggctttggcattgccctgagcacccacgccaacggt
ctggactcgccgcctatgttcgcaggtgcggggctgggaggcaacccgtgccgcaagagc
tacgaggactgtactagtggtatcatggaggactccgccatcaaatgcgagtacatgctt
aacgccatccccaagcgcctgtgcctcgtgtgcggggacattgcctctggctaccactac
ggagtggcctcctgcgaggcttgcaaggcgttcttcaagagaaccattcaaggcaacatc
gagtacaactgcccggccaccaatgaatgtgagatcaccaaacggaggcgcaagtcctgt
caggcctgccgattcatgaaatgcctcaaagtggggatgctgaaggaaggtgtgcgcctt
gaccgagttcgaggaggccgccagaagtacaagcgacggctggattcggagaacagcccc
tacctgaacctgccgatttccccacctgctaaaaagccattgactaagatcgtctcgaat
ctactaggggttgagcaggacaagctgtatgctatgcctcccaacgatatccccgaggga
gatatcaaggccctgaccactctctgtgaattggcagatcgggagcttgtgttcctcatc
aactgggccaagcacatcccaggcttccccagtctgacacttggggaccagatgagcctg
ctgcagagtgcctggatggagattctcatcttgggcatcgtgtaccgctcgctcccatac
gatgacaagctggcatacgccgaggactatatcatggatgaggaacactctcgcctggta
gggctgctggacctttaccgagccatcctgcagctggtgcgcaggtacaagaaactcaag
gtagagaaggaagagtttatgatcctcaaggccctggccctcgccaactcagattcgatg
tacattgagaacctggaggcggtgcagaagctccaggacctgctgcacgaggcgctgcag
gactatgagctgagtcagcgccacgaggagccgcggagggccggcaagctgctgctgacg
ctgcccctgctgaggcagacagccgccaaagccgtgcaacacttctacagtgtgaaactg
cagggcaaggtgcccatgcacaaactcttcctggagatgctggaggccaaggtgtga

DBGET integrated database retrieval system