KEGG   Mus musculus (mouse): 26383Help
Entry
26383             CDS       T01002                                 

Gene name
Fto, AW743446, mKIAA1752
Definition
(RefSeq) fat mass and obesity associated
  KO
K19469  mRNA N6-methyladenine demethylase [EC:1.14.11.53]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    26383 (Fto)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.53  mRNA N6-methyladenine demethylase
     26383 (Fto)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     26383 (Fto)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTO_NTD FTO_CTD
Motif
Other DBs
NCBI-GeneID: 26383
NCBI-ProteinID: NP_036066
MGI: 1347093
Ensembl: ENSMUSG00000055932
Vega: OTTMUSG00000025730
UniProt: Q8BGW1
Position
8 C4-C5; 8 44.34 cM
AA seq 502 aa AA seqDB search
MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLVFREAGSIPEE
LHKEVPEAFLTLHKHGCLFRDVVRIQGKDVLTPVSRILIGDPGCTYKYLNTRLFTVPWPV
KGCTVKYTEAEIAAACQTFLKLNDYLQVETIQALEELAVREKANEDAVPLCMAEFPRAGV
GPSCDDEVDLKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVA
VYSYSCEGSEDESEDESSFEGRDPDTWHVGFKISWDIETPGLTIPLHQGDCYFMLDDLNA
THQHCVLAGSQPRFSSTHRVAECSTGTLDYILERCQLALQNVLNDSDDGDVSLKSFDPAV
LKQGEEIHNEVEFEWLRQFWFQGNRYKLCTDWWCEPMTHLEGLWKKMESMTNAVLREVKR
EGLPVEQRSEILSAILVPLTVRQNLRKEWHARCQSRVVRTLPVQQKPDCRPYWEKDDPSM
PLPFDLTDVVSELRGQLLEARS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgtccagaccgcggaggaacgagagcgggaagctaagaaactgaggctcctt
gaggagcttgaagacacttggcttccttacctgacccccaaagatgatgagttctatcag
cagtggcagctgaaataccctaaactggttttccgagaggccggcagcataccagaggag
ctgcataaggaggtccccgaggcctttctcacactgcataagcatggctgcttgtttcgg
gacgtggtgaggatccaaggcaaagatgtgctcaccccagtgtctcgcatcctcatcggg
gacccaggctgcacctacaagtacttgaacaccagactcttcacggtgccctggcccgtg
aagggctgcacggtcaagtacacagaggctgagatcgccgctgcatgtcagaccttccta
aagctcaatgactacctccaggtggagaccatccaggccttggaagaactggctgtcaga
gagaaggccaatgaagacgctgtgccactgtgcatggcagagttccccagggccggcgtg
gggccgtcctgcgatgatgaagtggaccttaagagcagagcagcctacaacgtgactttg
ctaaacttcatggatcctcagaagatgccctacttgaaagaggagccctatttcggcatg
gggaagatggcggtgagctggcatcacgatgagaacctggtggacaggtcagccgtggca
gtgtacagctatagctgcgaaggctctgaggatgaaagtgaggacgagtccagcttcgaa
ggcagagatcctgatacttggcatgttggttttaagatctcttgggacatcgagacacca
ggattaacaatccctcttcaccagggagactgctatttcatgctggatgacctcaatgcc
acccaccagcactgtgttttggctggctcacagcctcggtttagttccactcaccgtgtg
gcagagtgctcaacaggcaccttggattatatcttagaacgctgtcagttggcgctgcag
aatgtcctcaatgactcagacgatggcgacgtctcgttgaaatcctttgatcctgcagtt
ttgaaacaaggagaggaaatccataatgaggtggagtttgagtggctgaggcagttctgg
tttcaaggcaatcgatacaaactttgcaccgattggtggtgtgagcccatgactcacctg
gaggggctgtggaagaagatggagagcatgacaaatgcggtgctccgtgaagttaaaaga
gaggggctcccggtggaacaaaggagtgagattctgtctgccatcctggtcccgctcacc
gtgcgccagaacctgaggaaggagtggcatgccaggtgccagtcccgagtcgtccggact
ttaccagtacagcagaaaccagactgccggccatattgggagaaggatgacccttccatg
cctctgccctttgacctcacagacgtggtttccgagctcagaggccagctgctggaagca
agatcctag

DBGET integrated database retrieval system