KEGG   Mus musculus (mouse): 26385Help
Entry
26385             CDS       T01002                                 

Gene name
Grk6, Gprk6
Definition
(RefSeq) G protein-coupled receptor kinase 6
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    26385 (Grk6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    26385 (Grk6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    26385 (Grk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26385 (Grk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     26385 (Grk6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   26385 (Grk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 26385
NCBI-ProteinID: NP_001106182
MGI: 1347078
Ensembl: ENSMUSG00000074886
UniProt: O70293
Position
13 B1; 13 30.06 cM
AA seq 576 aa AA seqDB search
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVSEYEVTPDEKRKACGRRLMQNFLSHTGPDLIPE
VPRQLVSNCAQRLEQGPCKDLFQELTRLTHEYLSTAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVRNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYTDRFSSQARSLC
SQLLSKDPAERLGCRGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVDLEPTDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPTAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgagaacatcgtagcgaacacggtgctactcaaggcccgggaaggtggtggc
gggaatcgcaaaggcaagagcaagaaatggcgccagatgctgcagttcccccatatcagc
cagtgtgaggagcttcgactcagccttgagcgtgactaccacagcctatgtgagcgccag
cccattgggcgcctgttatttcgtgagttctgtgctacgagacctgagctgacccggtgt
actgccttcctggatggggtgtctgaatatgaggtgacccctgatgagaagcggaaagca
tgtgggcgccgactaatgcagaactttctgagccacacgggtcctgacctcatccctgaa
gttccacggcagctggtgagtaactgtgcccagcggctagagcagggaccctgcaaagac
ctcttccaggagctgacccggctgacccacgagtacctgagcacggccccttttgccgac
tacctcgacagcatctacttcaaccgttttctgcagtggaagtggctggaaaggcaacca
gtgaccaaaaacaccttcaggcagtaccgagtcctgggcaaaggtggctttggggaggta
tgtgcctgccaggtgcgggcaacaggcaagatgtacgcatgcaagaaactggaaaagaag
cggataaagaagcgaaagggggaggccatggctctcaacgagaaacagatcttggagaaa
gtgaacagtaggtttgtagtgagcttagcctacgcctatgagaccaaggatgcactgtgc
ctggtgctgacattgatgaatggaggtgacctaaagttccacatctaccacatgggccag
gctggctttcctgaagcacgtgctgtcttctatgctgctgagatctgctgtggcctggaa
gacctgcaccgggaacgcattgtgtacagggatctaaagccagagaatatccttctggat
gaccatggccacattcggatctcggacctgggactggccgtgcatgtgcctgagggccag
accatcaaaggccgtgtgggcactgtgggctacatggctccagaggtggtgaggaatgag
cgctacacgttcagtcctgactggtgggcgctaggctgcctcctgtacgagatgatcgca
ggtcagtcgcccttccagcagaggaagaagaagataaagcgcgaagaggtggagcggctg
gtcaaggaagtggccgaggagtacacagaccgcttttcctcacaggcgcgctcactctgt
tctcagcttcttagcaaggaccctgctgagcgcctggggtgtcgtggaggtggcgcccgt
gaggtaaaggagcacccccttttcaagaaactgaatttcaagcggctgggagctggcatg
ctagagccaccttttaagcctgatccccaggctatttattgcaaggatgtcctggacatt
gaacagttctctacagttaaaggtgtggatctggagcccacagaccaagacttctaccag
aagtttgccacaggcagtgtgtccatcccctggcagaatgagatggtggagaccgagtgc
ttccaggaactcaatgtctttgggctggatgggtctgttcccccagacctggactggaag
ggccagcccactgcaccccccaagaagggattgctacagagactcttcagtcgccaagat
tgctgtgggaactgcagcgacagtgaggaagagctccccacccgcctctag

DBGET integrated database retrieval system