KEGG   Mus musculus (house mouse): 263876
Entry
263876            CDS       T01002                                 
Symbol
Spata2, AI504642, mKIAA0757
Name
(RefSeq) spermatogenesis associated 2
  KO
K17595  spermatogenesis-associated protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    263876 (Spata2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    263876 (Spata2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     263876 (Spata2)
SSDB
Motif
Pfam: PUB
Other DBs
NCBI-GeneID: 263876
NCBI-ProteinID: NP_739562
MGI: 2146885
Ensembl: ENSMUSG00000047030
UniProt: Q8K004
Position
2:complement(167323056..167334814)
AA seq 515 aa
MDTKYKDDLFRKYVQFHEGKVDTTPGNQQPGSDEYLRVAAATLLSLHKVDPLYRFRLIQF
YEVVESSLRSLSSSSLSALHCAFSMLETMAINLFLFPWKKEFRSIKTYTGPFVYYVKSTL
LEKDIRAILRFMGYEPELGTVYKLKELVESLQVKMVSFELFLAKVECEQMLGIHSQVKDK
GYSELDVVAERKGSTEDARGCSDALRRRAESREHLTTSMARVALQKSASERAAKDYYKPR
VTKPSRSVDAYDSYWESRKPPSKASLSLRKEPLAMDVGEDLKDEIIRPSPSLLAMSSSPH
GSPDDLSSISSINGLGLLRSTYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLVKNDTHP
IYHKRSPPTKESALSKCQNCGLSCSSSLCQRCDSVLVCPSASKPSAFPSKASVHDSLAHG
APMREKYVGHQTQGLDRLAPVHSKPKPSTTATSRCGFCNRAGATNTCTQCSKVSCDACLG
AYHYDPCCRKSELHKFLPNSQLNYKSAPFSQLVYR
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggatacgaagtacaaggatgacttattccggaagtacgtgcagttccatgagggcaaa
gtggacaccacccccggcaaccagcagcctggcagcgatgagtacctgcgcgtggcagct
gccaccctgctcagcctgcacaaggtggaccctttatatcgatttcggctgatccagttt
tatgaggtggtggagagctccctccgctcgctgagcagctccagcctgagtgctctgcac
tgcgccttcagcatgctggagacaatggccatcaacctcttcctgttcccctggaagaag
gagttccgcagcatcaagacctacactggcccttttgtttactatgtcaagtccacgttg
ctggagaaggacatccgagccattctaaggttcatgggctacgagcctgagttggggact
gtgtacaaactcaaagagcttgtggagtccctccaggtgaagatggtctcctttgagctc
ttcctggccaaggtcgagtgtgagcagatgctgggcatccactcgcaggtgaaggacaag
ggctactcagagctggacgtggtggctgagcgcaagggcagcacggaggatgcgcgcggg
tgctcagatgctctgcggaggcgggctgagagtcgggagcacctgaccacttccatggct
cgtgtggcactccagaaatcagccagtgagcgagcagccaaggactactacaagccccgg
gtgaccaaaccctccaggtctgtggatgcctacgacagctactgggagagcaggaagccc
ccttcaaaggcctcactgagtctgcgcaaggagcccctggccatggatgtaggggaagac
ttgaaggacgagatcatccgcccatccccctcattgctggccatgtccagctccccccat
ggtagccctgatgacctttcctccatctcctccatcaatggccttggccttcttcgtagt
acatacttttccactcaggatgacgtggacctgtatacggattcagaacccagggccacc
taccggaggcaggatgctctgcggcccgatgtgtggctggtcaaaaatgatacccacccc
atctaccacaagcgttcaccccccaccaaagagtctgccctctccaagtgccaaaactgc
ggcctgtcctgcagctcctccctctgccagcgctgtgacagtgtgctggtctgtccttcg
gcctccaagcccagcgctttccccagcaaggcttctgtacacgacagcttggcccacggg
gcacctatgcgggagaagtatgtgggccaccagactcagggccttgaccggctggcacct
gtccactcaaagcccaagccctctaccacagccacctcccgctgtggcttctgtaaccgt
gcaggtgccaccaacacgtgcacccagtgttcaaaagtttcctgtgacgcctgcctcggc
gcctaccactacgacccgtgctgcagaaagagtgagctgcacaagttcctgcccaacagt
cagctgaactacaagtccgccccgttctcccagctcgtgtacagatag

DBGET integrated database retrieval system