KEGG   Mus musculus (mouse): 26396Help
Entry
26396             CDS       T01002                                 

Gene name
Map2k2, AA589381, MEK2, MK2, Prkmk2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04620  Toll-like receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04934  Cushing's syndrome
mmu05020  Prion diseases
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Module
mmu_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26396 (Map2k2)
   04015 Rap1 signaling pathway
    26396 (Map2k2)
   04010 MAPK signaling pathway
    26396 (Map2k2)
   04012 ErbB signaling pathway
    26396 (Map2k2)
   04370 VEGF signaling pathway
    26396 (Map2k2)
   04371 Apelin signaling pathway
    26396 (Map2k2)
   04066 HIF-1 signaling pathway
    26396 (Map2k2)
   04068 FoxO signaling pathway
    26396 (Map2k2)
   04072 Phospholipase D signaling pathway
    26396 (Map2k2)
   04071 Sphingolipid signaling pathway
    26396 (Map2k2)
   04024 cAMP signaling pathway
    26396 (Map2k2)
   04022 cGMP - PKG signaling pathway
    26396 (Map2k2)
   04151 PI3K-Akt signaling pathway
    26396 (Map2k2)
   04150 mTOR signaling pathway
    26396 (Map2k2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    26396 (Map2k2)
  Cell growth and death
   04210 Apoptosis
    26396 (Map2k2)
   04218 Cellular senescence
    26396 (Map2k2)
  Cellular community - eukaryotes
   04540 Gap junction
    26396 (Map2k2)
   04550 Signaling pathways regulating pluripotency of stem cells
    26396 (Map2k2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    26396 (Map2k2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26396 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    26396 (Map2k2)
   04660 T cell receptor signaling pathway
    26396 (Map2k2)
   04662 B cell receptor signaling pathway
    26396 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    26396 (Map2k2)
  Endocrine system
   04910 Insulin signaling pathway
    26396 (Map2k2)
   04912 GnRH signaling pathway
    26396 (Map2k2)
   04915 Estrogen signaling pathway
    26396 (Map2k2)
   04917 Prolactin signaling pathway
    26396 (Map2k2)
   04921 Oxytocin signaling pathway
    26396 (Map2k2)
   04926 Relaxin signaling pathway
    26396 (Map2k2)
   04919 Thyroid hormone signaling pathway
    26396 (Map2k2)
   04916 Melanogenesis
    26396 (Map2k2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    26396 (Map2k2)
  Nervous system
   04720 Long-term potentiation
    26396 (Map2k2)
   04730 Long-term depression
    26396 (Map2k2)
   04722 Neurotrophin signaling pathway
    26396 (Map2k2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    26396 (Map2k2)
   05230 Central carbon metabolism in cancer
    26396 (Map2k2)
   05231 Choline metabolism in cancer
    26396 (Map2k2)
   05206 MicroRNAs in cancer
    26396 (Map2k2)
   05205 Proteoglycans in cancer
    26396 (Map2k2)
   05210 Colorectal cancer
    26396 (Map2k2)
   05225 Hepatocellular carcinoma
    26396 (Map2k2)
   05226 Gastric cancer
    26396 (Map2k2)
   05214 Glioma
    26396 (Map2k2)
   05216 Thyroid cancer
    26396 (Map2k2)
   05221 Acute myeloid leukemia
    26396 (Map2k2)
   05220 Chronic myeloid leukemia
    26396 (Map2k2)
   05218 Melanoma
    26396 (Map2k2)
   05211 Renal cell carcinoma
    26396 (Map2k2)
   05219 Bladder cancer
    26396 (Map2k2)
   05215 Prostate cancer
    26396 (Map2k2)
   05213 Endometrial cancer
    26396 (Map2k2)
   05224 Breast cancer
    26396 (Map2k2)
   05223 Non-small cell lung cancer
    26396 (Map2k2)
  Neurodegenerative diseases
   05020 Prion diseases
    26396 (Map2k2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    26396 (Map2k2)
  Infectious diseases
   05164 Influenza A
    26396 (Map2k2)
   05161 Hepatitis B
    26396 (Map2k2)
   05163 Human cytomegalovirus infection
    26396 (Map2k2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    26396 (Map2k2)
   05165 Human papillomavirus infection
    26396 (Map2k2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    26396 (Map2k2)
   01522 Endocrine resistance
    26396 (Map2k2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26396 (Map2k2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26396 (Map2k2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 26396
NCBI-ProteinID: NP_075627
MGI: 1346867
Ensembl: ENSMUSG00000035027
Vega: OTTMUSG00000016975
UniProt: Q63932 Q8CB46
Position
10 C1; 10 39.72 cM
AA seq 401 aa AA seqDB search
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRP
PGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERAD
LKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttaccggcactcactatcaaccctaccatcgccgag
ggcccgtcccccaccagcgagggcgcctctgaggcaaacctggtggacctccagaagaag
ctggaagagctggacctggatgagcagcaaaggaagcggctggaggccttccttacccag
aaggctaaggtcggtgagctcaaggacgacgactttgagaggatctcagagctgggtgcc
ggcaatggcggagtggtcaccaaggcccggcataggccgtcaggcctcatcatggccaga
aagctgatccacctggagatcaaaccggccgtgcgcaaccagatcatccgggagctgcag
gtgctgcacgagtgcaactcgccctacatcgtgggcttctatggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtactgaag
gaggccaagcggattcctgaagacatcttggggaaggtcagcattgcggtgctccggggc
ctggcctacctccgagagaagcaccagatcatgcacagagatgtgaagccctccaacatc
ctggtgaactctcgcggggagattaagctgtgtgacttcggggtgagcggccagctgatc
gactccatggccaactcgtttgtagggacgcgctcctacatgtccccagagcggctgcag
ggcacccactactctgtgcagtcggacatctggagcatggggctgtcgctggtggagctg
gccatcgggaggtatcccattcccccacctgatgccaaggaactagaggccagctttggc
cggcctgtggtggacggggcagacggagaaccccatagtgtctccccgaggcccaggccc
cctggacgccccatcagtgtaggtcatgggatggacagccgaccggccatggccatcttt
gagctgctggactacatagtgaacgagccacctcccaagctgcccagtggtgtgttcagc
tcagacttccaggagtttgtgaataaatgtctcattaagaacccagcagagcgagcagat
ctgaagctgctgatgaaccacgccttcatcaagcgctctgagggggaggaagtggacttc
gccggctggctgtgcagaaccctgcggctgaagcagcccagcacacccacgcggactgca
gtgtga

DBGET integrated database retrieval system