KEGG   Mus musculus (mouse): 26397Help
Entry
26397             CDS       T01002                                 

Gene name
Map2k3, AW212142, MAPKK_3, MEK3, MKK3, MKK3b, Prkmk3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04218  Cellular senescence
mmu04620  Toll-like receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Module
mmu_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    26397 (Map2k3)
   04010 MAPK signaling pathway
    26397 (Map2k3)
   04668 TNF signaling pathway
    26397 (Map2k3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    26397 (Map2k3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26397 (Map2k3)
   04664 Fc epsilon RI signaling pathway
    26397 (Map2k3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26397 (Map2k3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26397 (Map2k3)
  09159 Environmental adaptation
   04714 Thermogenesis
    26397 (Map2k3)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    26397 (Map2k3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    26397 (Map2k3)
   05164 Influenza A
    26397 (Map2k3)
   05161 Hepatitis B
    26397 (Map2k3)
   05169 Epstein-Barr virus infection
    26397 (Map2k3)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    26397 (Map2k3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26397 (Map2k3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26397 (Map2k3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26397 (Map2k3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Pkinase_fungal Choline_kinase RIO1 DHR-2 DUF4344
Motif
Other DBs
NCBI-GeneID: 26397
NCBI-ProteinID: NP_032954
MGI: 1346868
Ensembl: ENSMUSG00000018932
Vega: OTTMUSG00000006341
UniProt: O09110 Q5SWN9
Position
11; 11 B2
AA seq 347 aa AA seqDB search
MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVD
FTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgccgcgagcccgccggccagcttgcctcagaccaaaggaaaatccaaa
aggaaaaaggacttacggatatcctgcgtgtccaagccacctgtgtccaaccccacaccc
ccccggaacctggactcccggaccttcatcactatcggagacagaaacttcgaagtggag
gctgatgacttggtgaccatctcagagctgggtcgtggagcctatggggtggtagagaaa
gtgcggcatgctcagagtggtaccatcatggctgtcaagcgcatccgggccacagtgaac
acacaggagcagaaacgtctgcttatggacctagacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctatggtgccctcttcagagagggggatgtatggatctgcatg
gagctcatggacacttccctggataagttctaccggaaggtgctggagaagaacatgaaa
attccggaagacatcctgggggagatcgctgtgtctatcgtgcgggccctggagcacctg
catagcaagctgtctgtgatccacagagatgtgaagccatccaatgtcctcatcaacaag
gaagggcatgtgaagatgtgcgactttggcatcagtggctacctggtggactctgtggca
aagacaatggatgctggctgcaagccttacatggcccctgagaggatcaaccctgaactg
aatcagaagggctacaatgtcaagtctgatgtctggagcctcggcatcaccatgatcgag
atggccattctgcgattcccttatgagtcttggggcacaccgttccagcagctgaagcag
gtggtggaggagccatccccacagctcccagcggaccagttctcccctgagtttgtggac
ttcactagccagtgcctaaggaagaaccctgcagagcgcatgagctacctggagctgatg
gaacacccattcttcaccttgcacaaaactaagaagacagacattgctgcctttgtgaag
gagatcctgggagaggattcatag

DBGET integrated database retrieval system