KEGG   Mus musculus (mouse): 26398
Entry
26398             CDS       T01002                                 

Gene name
Map2k4, JNKK, JNKK1, MAPKK_4, MEK4, MKK4, PRKMK4, Sek, Sek1, Ser, Serk1
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04912  GnRH signaling pathway
mmu04926  Relaxin signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26398 (Map2k4)
   04012 ErbB signaling pathway
    26398 (Map2k4)
   04668 TNF signaling pathway
    26398 (Map2k4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26398 (Map2k4)
   04664 Fc epsilon RI signaling pathway
    26398 (Map2k4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26398 (Map2k4)
   04926 Relaxin signaling pathway
    26398 (Map2k4)
   04935 Growth hormone synthesis, secretion and action
    26398 (Map2k4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26398 (Map2k4)
   05161 Hepatitis B
    26398 (Map2k4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26398 (Map2k4)
   05169 Epstein-Barr virus infection
    26398 (Map2k4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26398 (Map2k4)
   05135 Yersinia infection
    26398 (Map2k4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    26398 (Map2k4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    26398 (Map2k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26398 (Map2k4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26398 (Map2k4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26398 (Map2k4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 26398
NCBI-ProteinID: NP_033183
MGI: 1346869
Ensembl: ENSMUSG00000033352
Vega: OTTMUSG00000005905
UniProt: P47809 Q543X6
Position
11 B3; 11 40.53 cM
AA seq 397 aa
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLN
PNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHK
PSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS
TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGN
IKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELAT
GRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELL
KHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcggacctccagcttctggccacccggcggtcagcagcatgcagggtaagcgcaaa
gcactgaagttgaattttgcaaatccacctgtcaaatcgacagcacggtttactctgaat
cctaatactacaggagtccagaacccacacatagagagactgagaacacacagcattgag
tcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggacttg
aaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaa
ccaagtgggcagataatggcagttaaaagaattcggtcaactgtggatgaaaaagaacaa
aaacaacttctcatggatttggatgtagtaatgcggagtagtgattgcccatacattgtt
cagttctatggtgcactcttcagagagggcgactgttggatctgtatggagctcatgtct
acctcgttcgataagttttacaaatatgtatatagtgtgttagatgacgttattccggaa
gagatcttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaac
ttgaaaattattcacagagacatcaaaccttccaatattcttctggacagaagtggaaat
ataaagctctgtgatttcggcatcagtggacagcttgtggactctattgccaagacaaga
gatgctgggtgtaggccgtatatggcacctgaaagaatagacccaagtgcatcaagacaa
gggtatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggccaca
ggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaagtggtgaaa
ggagaccctccgcagctgagtaattctgaagaaagggagttctcccccagtttcatcaac
tttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagagcttctg
aaacatccctttattttgatgtatgaagaacgtactgtagaggtcgcatgctatgtttgt
aaaatcctggatcagatgccagccactcccagctcgcccatgtatgtcgactga

KEGG   Mus musculus (mouse): 26400
Entry
26400             CDS       T01002                                 

Gene name
Map2k7, 5930412N11Rik, JNKK_2, Jnkk, Jnkk2, MAPKK_7, MEK_7, Mapkk7, Mek7, Mkk7, Prkm, Prkmk7, sek, sek2
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04380  Osteoclast differentiation
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04912  GnRH signaling pathway
mmu04926  Relaxin signaling pathway
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05161  Hepatitis B
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26400 (Map2k7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26400 (Map2k7)
   04012 ErbB signaling pathway
    26400 (Map2k7)
   04668 TNF signaling pathway
    26400 (Map2k7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    26400 (Map2k7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26400 (Map2k7)
   04660 T cell receptor signaling pathway
    26400 (Map2k7)
   04664 Fc epsilon RI signaling pathway
    26400 (Map2k7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26400 (Map2k7)
   04926 Relaxin signaling pathway
    26400 (Map2k7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    26400 (Map2k7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26400 (Map2k7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26400 (Map2k7)
   05161 Hepatitis B
    26400 (Map2k7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26400 (Map2k7)
   05169 Epstein-Barr virus infection
    26400 (Map2k7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26400 (Map2k7)
   05135 Yersinia infection
    26400 (Map2k7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26400 (Map2k7)
   05016 Huntington disease
    26400 (Map2k7)
   05022 Pathways of neurodegeneration - multiple diseases
    26400 (Map2k7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    26400 (Map2k7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26400 (Map2k7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26400 (Map2k7)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26400 (Map2k7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 26400
NCBI-ProteinID: NP_001036022
MGI: 1346871
Ensembl: ENSMUSG00000002948
Vega: OTTMUSG00000059344
UniProt: Q8CE90
Position
8; 8 A1.1
AA seq 468 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTESP
RTSGVLSQHHLPFFSGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagccaagctgaagcaggag
aaccgtgaggcccgcaggaggatcgacctcaacttggatatcagcccacagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccagcgagcagccctgcaa
ctcccactggccaacgatgggggcagccgctcaccatcctcagagagctccccacagcac
cctacaccccccacccggccccgccacatgctggggctcccatcaaccttgttcacaccg
cgcagtatggagagcatcgagattgaccagaagctgcaggagatcatgaagcagacaggg
tacctgactatcgggggccagcgttatcaggcagaaatcaatgacttggagaacttgggt
gagatgggcagtggtacctgtggtcaggtgtggaagatgcggttccggaagacaggccac
atcattgctgttaagcaaatgcggcgctctgggaacaaggaagagaataagcgcattttg
atggacctggatgtagtactcaagagccatgactgcccttacatcgttcagtgctttggc
accttcatcaccaacacagacgtctttattgccatggagctcatgggcacatgtgcagag
aagctgaagaaacgaatgcagggccccattccagagcgaatcctgggcaagatgactgtg
gcgattgtgaaagcactgtactatctgaaggagaagcatggcgtcatccatcgcgatgtc
aaaccctccaacatcctgctagatgagcggggccagatcaagctctgtgactttggcatc
agtggccgccttgttgactccaaagccaaaacacggagtgctggctgtgctgcctatatg
gctcccgagcgcatcgaccctccagatcccaccaagcctgactatgacatccgagctgat
gtgtggagcctgggcatctcactggtggagctggcaacaggacagttcccctataagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccactcctgcct
ggtcacatgggcttctcaggggacttccagtcatttgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcactatgag
atactcgaggtggatgtcgcgtcctggtttaaggatgtcatggcgaagaccgagtcccca
aggactagtggagtcctgagtcagcaccatctgcccttcttcagtgggagtctggaggag
tctcccacttccccaccttctcccaagtccttccctctgtcaccagccatccctcaggcc
caggcagagtgggtctcgggcaggtag

DBGET integrated database retrieval system