KEGG   Mus musculus (mouse): 26399
Entry
26399             CDS       T01002                                 

Gene name
Map2k6, MAPKK_6, MAPKK6, MEK6, MKK6, Prkm, Prkmk6, SAP, SAPKK3
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04218  Cellular senescence
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26399 (Map2k6)
   04015 Rap1 signaling pathway
    26399 (Map2k6)
   04668 TNF signaling pathway
    26399 (Map2k6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    26399 (Map2k6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26399 (Map2k6)
   04664 Fc epsilon RI signaling pathway
    26399 (Map2k6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26399 (Map2k6)
   04935 Growth hormone synthesis, secretion and action
    26399 (Map2k6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26399 (Map2k6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26399 (Map2k6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26399 (Map2k6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26399 (Map2k6)
   05161 Hepatitis B
    26399 (Map2k6)
   05163 Human cytomegalovirus infection
    26399 (Map2k6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26399 (Map2k6)
   05169 Epstein-Barr virus infection
    26399 (Map2k6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26399 (Map2k6)
   05135 Yersinia infection
    26399 (Map2k6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26399 (Map2k6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    26399 (Map2k6)
   05022 Pathways of neurodegeneration - multiple diseases
    26399 (Map2k6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26399 (Map2k6)
   05418 Fluid shear stress and atherosclerosis
    26399 (Map2k6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26399 (Map2k6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26399 (Map2k6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26399 (Map2k6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Seadorna_VP7 Pkinase_fungal CLP1_P Haspin_kinase Choline_kinase APH DUF4344
Other DBs
NCBI-GeneID: 26399
NCBI-ProteinID: NP_036073
MGI: 1346870
Ensembl: ENSMUSG00000020623
Vega: OTTMUSG00000003325
UniProt: P70236 Q543Z5
Position
11; 11 E1- E2
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSADFVDFTSQCLKKNSK
ERPTYPELMQHPFFTVHESKAADVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaacccgggccttaagattccaaaagaagcgttt
gaacagcctcagaccagttccacgccgcctcgggatttagactccaaggcttgcatatct
attggaaaccagaactttgaggtgaaggcagatgacctggagccgatagtggagctggga
cgaggtgcgtacggggtggtggagaagatgcgtcacgtgcccagcgggcagatcatggca
gtgaagcggatacgggccacagttaatagccaggaacagaaacggctgctgatggatttg
gatgtctccatgaggacggtggactgtccattcaccgtgaccttctacggtgcactcttc
cgggagggcgacgtgtggatctgcatggagctcatggatacgtcactagataaattctac
aaacaagttattgataaaggccaaacaattccagaggatatcttaggaaagatagcagtt
tctattgtaaaagcgttagaacatttacacagtaagctgtctgttatccatcgagacgtc
aagccttctaatgtgctcattaacacactgggccaggtgaagatgtgtgactttggaatc
agtggctacctggtcgactctgttgctaaaacgatcgatgccggttgcaaaccatacatg
gctcctgaacgaataaatccagagctcaaccagaaggggtacagtgtgaagtctgacatt
tggagcctgggcatcaccatgatcgagctggccatccttcggtttccttatgattcttgg
ggaacgcccttccagcagctaaagcaggtggtcgaagagccctctcctcagctcccagca
gacaagttctccgcggactttgttgactttacctcacagtgcttgaagaaaaattccaaa
gaacggcccacatatccagagcttatgcaacatccatttttcaccgtacatgaatccaaa
gcagcagacgtggcatcttttgtaaaactgatacttggggactaa

DBGET integrated database retrieval system