KEGG   Mus musculus (mouse): 26401Help
Entry
26401             CDS       T01002                                 

Gene name
Map3k1, MAPKKK1, MEKK1, Mekk
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04530  Tight junction
mmu04622  RIG-I-like receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04912  GnRH signaling pathway
mmu05161  Hepatitis B
mmu05166  HTLV-I infection
Module
mmu_M00688  MAPK (JNK) signaling
mmu_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26401 (Map3k1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26401 (Map3k1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    26401 (Map3k1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    26401 (Map3k1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26401 (Map3k1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    26401 (Map3k1)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    26401 (Map3k1)
   05161 Hepatitis B
    26401 (Map3k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26401 (Map3k1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26401 (Map3k1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26401 (Map3k1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE11 family
   26401 (Map3k1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    26401 (Map3k1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like zf-RING_2 SWIM PHD APH Phostensin_N FANCL_C zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 26401
NCBI-ProteinID: NP_036075
MGI: 1346872
Ensembl: ENSMUSG00000021754
Vega: OTTMUSG00000020184
UniProt: F8VQ72
Position
13 D2.2; 13 63.36 cM
AA seq 1493 aa AA seqDB search
MAAAAGDRASSSGFPGAAAASPEAGGGGGGGGALQGSGAPAAGAAGLLREPGSAGRERAD
WRRRQLRKVRSVELDQLPEQPLFLAAASPPCPSTSPSPEPADAAAGASRFQPAAGPPPPG
AASRCGSHSAELAAARDSGARSPAGAEPPSAAAPSGREMENKETLKGLHKMEDRPEERMI
REKLKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEMNNLAAEPQGEGQAGSAAPAP
KGRRSPSPGSSPSGRSVKPESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYSPEETS
RRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGAFCIHLLFVMLRV
FQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNCHTLSSSS
TSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREP
LICPLCRSKWRSHDFYSHELSSPVESPTSLRAVQQPSSPQQPVAGSQRRNQESSFNLTHF
GTQQIPSAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTG
NSGGGSGGSLSAGAASGSSQPSISGDVVEACCSVLSIVCADPVYKVYVAALKTLRAMLVY
TPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTVLELCKGQAGELAVGREIL
KAGSIGVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTDVSQA
EPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTAVPAVFSKLVTMLNAS
GSTHFTRMRRRLMAIADEVEIAEVIQLGVEDTVDGHQDSLQVLAPASCLENSSLEHTVHR
EKTGKGLSATRLSASSEDISDRLAGVSVGLPSSTTTEQPKPAVQTKGRPHSQCLNSSPLS
HAQLMFPAPSAPCSSAPSVPDISKHRPQAFVPCKIPSASPQTQRKFSLQFQRNCSEHRDS
DQLSPVFTQSRPPPSSNIHRPKPSRPVPGSTSKLGDATKSSMTLDLGSASRCDDSFGGGG
NSGNAVIPSEETVFTPVEDKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPE
KAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVPQLQVENGEDIIII
QQDTPETLPGHTKAKQPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRN
TSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSNYNLFIEWMAGGSVAHLLSKYG
AFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKG
TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLA
LIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
NT seq 4482 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcgatcgcgcctcgtcgtcgggattcccgggcgccgcggcggcg
agtcccgaggcgggcggcggcggcggaggaggaggagctctccagggaagcggcgcgccc
gcagcgggcgcggcggggctgctgcgggagcctggcagcgcgggccgcgagcgcgcggac
tggcggcggcggcagctgcgcaaagtgcggagtgtggagctggaccagctgccggagcag
ccgctcttcctcgccgccgcctcgccgccctgcccatctacttccccgtcgccggagccc
gcggacgcggctgcaggagcgagtcgcttccagcccgcggcgggaccgccacccccggga
gcggcgagtcgctgcggctcccactctgccgagctggcggccgcgcgggacagcggcgcc
cggagccccgcgggggccgagccgccctctgcagcggccccctccggtcgagagatggag
aataaagaaaccctcaaaggactgcacaagatggaggatcgcccggaggagagaatgatc
cgggagaagctcaaggcgacctgtatgcccgcctggaagcacgagtggttggagaggagg
aacaggagaggccctgtggtggtgaagccaatccctattaaaggagatggatctgaaatg
aataacttggcagctgagccccaaggagagggccaggcaggttccgctgcaccagccccc
aagggccgacgaagcccatctcctggcagctctccgtcagggcgctcggtgaagccggaa
tccccaggagtgagacggaaacgagtgtccccggtgcctttccagagtggcagaatcaca
ccaccccgaagagccccgtcaccggatggcttctccccgtacagcccagaggagacgagc
cgccgcgtgaacaaagtgatgagagccaggctgtacctgctgcagcagataggacccaac
tctttcctgattggaggagacagtccagacaataaataccgggtgtttattgggccacag
aactgcagctgtgggcgtggagcattctgtattcacctcttgtttgtcatgctccgggtg
tttcagctagaaccctctgaccccatgttatggagaaaaactttaaaaaatttcgaggtt
gagagtttgttccagaaataccacagtaggcgtagctcgagaatcaaagctccatcccgg
aacaccatccagaagtttgtgtcacgcatgtcaaattgtcacacactgtcatcgtctagc
acatccacatctagttcagaaaacagcatcaaggatgaagaggagcagatgtgtcccatc
tgcttgctgggcatgctggatgaggagagcctgactgtgtgtgaagatggctgcaggaac
aagctgcaccaccattgcatgtccatctgggcggaagagtgtagaagaaatagagagcct
ttaatatgtcccctttgtagatctaagtggagatcccatgacttctacagccatgagtta
tcaagccccgtggagtcccccacctccctgcgagctgtccagcagccatcctccccacag
cagcccgtggccggatcacagcgaaggaatcaggagagcagttttaaccttactcatttt
ggaacccagcagattccttccgcttacaaagatttggccgagccatggattcaggtgttt
ggaatggaactcgttggctgcttattctctagaaactggaacgtaagggaaatggccctt
aggcgtctttcccacgacgttagtggggccctgttgttggcaaacggggagagcactgga
aactctggaggcggcagtgggggcagcttaagcgcgggagcggccagcgggtcctcccag
cccagcatctcaggggatgtggtggaggcgtgctgcagtgtcctgtctatagtctgcgct
gaccctgtctacaaagtgtacgttgctgctttaaaaacattgagagccatgctggtatac
actccttgccacagtctggcagaaagaatcaaacttcagagactcctccggccagttgta
gacactatccttgtcaagtgtgcagatgccaacagccgcacgagtcagctgtccatatct
acagtgctggaactctgcaagggccaagcaggagagctggcggttgggagagaaatactt
aaagctgggtccatcggggttggtggtgtcgattacgtcttaagttgtatccttggaaac
caagctgaatcaaacaactggcaagaactgctgggtcgcctctgtcttatagacaggttg
ctgttggaatttcctgctgaattctatcctcatattgtcagtactgatgtctcacaagct
gagcctgttgaaatcaggtacaagaagctgctctccctcttaacctttgccttgcaatcc
attgacaattcccactcgatggttggcaagctctctcggaggatatatctgagctctgcc
aggatggtgaccgcagtgcccgctgtgttttccaagctggtaaccatgcttaatgcttct
ggctccacccacttcaccaggatgcgccggcgtctgatggctatcgcggatgaggtagaa
attgccgaggtcatccagctgggtgtggaggacactgtggatgggcatcaggacagctta
caggtgctggcccccgccagctgtctagaaaacagctcccttgagcacacagtccataga
gagaaaactggaaaaggactaagtgctacgagactgagtgccagctcggaggacatttct
gacagactggccggcgtctctgtaggacttcccagctcaacaacaacagaacaaccaaag
ccagcggttcaaacaaaaggcagaccccacagtcagtgtttgaactcctcccctttgtct
catgctcaattaatgttcccagcaccatcagccccttgttcctctgccccgtctgtccca
gatatttctaagcacagaccccaggcatttgttccctgcaaaataccttccgcatctcct
cagacacagcgcaagttctctctacaattccagaggaactgctctgaacaccgagactca
gaccagctctccccagtcttcactcagtcaaggcccccaccctccagtaacatacacagg
ccaaagccatcccgacccgttccgggcagtacaagcaaactaggggacgccacaaaaagt
agcatgacacttgatctgggcagtgcttccaggtgtgacgacagctttggcggcggcggc
aacagtggcaacgccgtcatacccagcgaagagacagtgttcacgccggtggaggacaag
tgcaggttagatgtgaacaccgagctcaactccagcatcgaggaccttcttgaagcatcc
atgccttcaagtgacacgacagtcactttcaagtccgaagtcgccgtcctctctccggaa
aaggccgaaaatgacgacacctacaaagacgacgtcaatcataatcaaaagtgcaaagaa
aagatggaagctgaagaggaggaggctttagcgatcgccatggcgatgtcagcgtctcag
gatgccctccccatcgtccctcagctgcaggtggaaaatggagaagatattatcatcatt
cagcaggacacaccagaaactcttccaggacataccaaagcgaaacagccttacagagaa
gacgctgagtggctgaaaggccagcagataggcctcggagcattttcttcctgttaccaa
gcacaggatgtggggactgggactttaatggctgtgaaacaggtgacgtacgtcagaaac
acatcctccgagcaggaggaggtggtggaagcgttgagggaagagatccggatgatgggt
cacctcaaccatccaaacatcatccggatgctgggggccacgtgcgagaagagcaactac
aacctcttcattgagtggatggcgggaggatctgtggctcacctcttgagtaaatacgga
gctttcaaggagtcagtcgtcattaactacactgagcagttactccgtggcctttcctat
ctccacgagaaccagatcattcacagagacgtcaaaggtgccaacctgctcattgacagc
accggtcagaggctgagaattgcagactttggagctgctgccaggttggcatcaaaagga
accggtgcaggagagttccagggacagttactggggacaattgcattcatggcgcctgag
gtcctaagaggtcagcagtatggtaggagctgtgatgtatggagtgttggctgcgccatt
atagaaatggcttgtgcaaaaccaccttggaatgcagaaaaacactccaatcatctcgcc
ttgatatttaagattgctagcgcaactactgcaccgtccatcccgtcacacctgtccccg
ggtctgcgcgacgtggcgctgcgctgcttagaacttcagcctcaggaccggcctccgtcc
agagagctgctgaaacatccggtcttccgtaccacgtggtag

DBGET integrated database retrieval system