KEGG   Mus musculus (mouse): 26410
Entry
26410             CDS       T01002                                 

Gene name
Map3k8, Cot, Cot/Tpl2, Est, Estf, Tpl-2, Tpl2, c-COT
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 8
  KO
K04415  mitogen-activated protein kinase kinase kinase 8 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26410 (Map3k8)
   04668 TNF signaling pathway
    26410 (Map3k8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26410 (Map3k8)
   04660 T cell receptor signaling pathway
    26410 (Map3k8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26410 (Map3k8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26410 (Map3k8)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  Other
   26410 (Map3k8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal HTH_8 APH RIO1
Other DBs
NCBI-GeneID: 26410
NCBI-ProteinID: NP_031772
MGI: 1346878
Ensembl: ENSMUSG00000024235
Vega: OTTMUSG00000037645
UniProt: Q07174 Q3UEB8
Position
18 A1; 18 2.73 cM
AA seq 467 aa
MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPSLMTMYPDSNQNEERS
ESLLRSGQEVPWLSSVRYGTVEDLLAFANHVSNMTKHFYGRRPQECGILLNMVISPQNGR
YQIDSDVLLVPWKLTYRNIGSGFVPRGAFGKVYLAQDMKTKKRMACKLIPIDQFKPSDVE
IQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHILKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVKMTEDVYLPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIAGDCSPG
MRELIEAALERNPNHRPKAADLLKHEALNPPREDQPRCQSLDSALFERKRLLSRKELQLP
ENIADSSCTGSTEESEVLRRQRSLYIDLGALAGYFNIVRGPPTLEYG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggagtacatgagcactggaagtgacgagaaagaagaaattgatttattaattaagcat
ttaaacgtgtcagaagtcatagacataatggagaacctttatgcaagtgaagagccagga
gtgtatgagcccagtctgatgaccatgtatccagacagcaatcaaaatgaggaacgttcg
gagtcactgcttcggagtggccaggaggttccctggctgtcatctgtcagatatgggacc
gtggaggatctgcttgcatttgcaaaccatgtctccaatatgacaaagcatttttatgga
cgtcgaccacaagaatgtggaattttattaaatatggtaatcagtccccagaatggccgc
taccaaatcgattcggatgttctccttgttccttggaagctgacatacaggaacatcggc
tctggtttcgttcctcggggggcctttggaaaagtatacttagcccaagacatgaagaca
aagaaaagaatggcgtgcaaactgatccctatagatcagtttaagccatcggatgtggaa
atccaggcctgtttccggcatgagaacattgctgagttatatggtgccgtcctatggggc
gatactgtccatctctttatggaagccggcgagggagggtctgttctggagaaactggag
agttgtgggcccatgagagaatttgaaattatttgggtgacgaagcacattctcaaggga
cttgattttctgcactccaagaaagtgatccaccatgatattaaacctagcaacattgta
ttcatgtctacaaaagctgttttggtagattttggcctgagtgttaagatgactgaagat
gtctatcttcccaaggacctccggggaacagagatatacatgagcccagaggtgatccta
tgtcggggccattccacaaaagccgacatctacagccttggagccacactcatccacatg
cagacaggcaccccaccctgggtgaagcgctaccctcgatcagcctatccctcctaccta
tacattatccacaagcaggcacctcccctggaagacatcgctggtgactgcagtccaggc
atgagggagctgatagaagctgccctggagaggaaccccaaccaccgccccaaagcagca
gacctactgaaacatgaagccctgaatcccccaagagaggaccagccacgatgtcagagt
ctggactctgccctctttgaacggaagaggctgctgagcaggaaggaactacaacttcct
gagaacattgctgattcatcatgcacaggcagcaccgaagagtctgaagtgctcaggaga
cagcgttccctctacattgacctcggagctctggctggctacttcaatattgttcgtggg
ccaccaaccctggaatacggctga

DBGET integrated database retrieval system