KEGG   Mus musculus (house mouse): 26416
Entry
26416             CDS       T01002                                 
Symbol
Mapk14, CSBP2, Crk1, Csbp1, Mxi2, PRKM14, PRKM15, p38, p38-alpha, p38MAPK, p38a, p38alpha
Name
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu04936  Alcoholic liver disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26416 (Mapk14)
   04015 Rap1 signaling pathway
    26416 (Mapk14)
   04370 VEGF signaling pathway
    26416 (Mapk14)
   04668 TNF signaling pathway
    26416 (Mapk14)
   04068 FoxO signaling pathway
    26416 (Mapk14)
   04071 Sphingolipid signaling pathway
    26416 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    26416 (Mapk14)
   04218 Cellular senescence
    26416 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    26416 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    26416 (Mapk14)
   04613 Neutrophil extracellular trap formation
    26416 (Mapk14)
   04620 Toll-like receptor signaling pathway
    26416 (Mapk14)
   04621 NOD-like receptor signaling pathway
    26416 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    26416 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    26416 (Mapk14)
   04660 T cell receptor signaling pathway
    26416 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    26416 (Mapk14)
   04659 Th17 cell differentiation
    26416 (Mapk14)
   04657 IL-17 signaling pathway
    26416 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    26416 (Mapk14)
   04670 Leukocyte transendothelial migration
    26416 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26416 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    26416 (Mapk14)
   04917 Prolactin signaling pathway
    26416 (Mapk14)
   04926 Relaxin signaling pathway
    26416 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    26416 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    26416 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    26416 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    26416 (Mapk14)
   04722 Neurotrophin signaling pathway
    26416 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26416 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26416 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    26416 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    26416 (Mapk14)
   05208 Chemical carcinogenesis - reactive oxygen species
    26416 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26416 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26416 (Mapk14)
   05161 Hepatitis B
    26416 (Mapk14)
   05171 Coronavirus disease - COVID-19
    26416 (Mapk14)
   05163 Human cytomegalovirus infection
    26416 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26416 (Mapk14)
   05169 Epstein-Barr virus infection
    26416 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26416 (Mapk14)
   05135 Yersinia infection
    26416 (Mapk14)
   05133 Pertussis
    26416 (Mapk14)
   05152 Tuberculosis
    26416 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26416 (Mapk14)
   05140 Leishmaniasis
    26416 (Mapk14)
   05142 Chagas disease
    26416 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    26416 (Mapk14)
   05020 Prion disease
    26416 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    26416 (Mapk14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26416 (Mapk14)
   05418 Fluid shear stress and atherosclerosis
    26416 (Mapk14)
   05415 Diabetic cardiomyopathy
    26416 (Mapk14)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    26416 (Mapk14)
   04932 Non-alcoholic fatty liver disease
    26416 (Mapk14)
   04933 AGE-RAGE signaling pathway in diabetic complications
    26416 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    26416 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26416 (Mapk14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26416 (Mapk14)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26416 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 26416
NCBI-ProteinID: NP_001161980
MGI: 1346865
Ensembl: ENSMUSG00000053436
UniProt: P47811 Q5U421
Structure
Position
17:28910243..28967379
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgaacgataccagaacctgtccccggtgggctcgggcgcctatggctcggtgtgtgct
gcttttgatacaaagacggggcatcgtgtggcagttaagaagctgtcgagaccgtttcag
tccatcattcacgccaaaaggacctaccgagagttgcgtctgctgaagcacatgaaacac
gaaaatgtgattggtctgttggatgtgttcacacccgcaaggtcactggaggaattcaat
gacgtgtacctggtgacccatctcatgggggcggacctgaacaacatcgtgaagtgccag
aagctgaccgacgaccacgttcagtttctcatctaccagatcctccgagggctgaagtat
atacattcggctgacataattcacagggacctaaagcccagcaacctagctgtgaacgaa
gactgtgagctcaagattctggattttgggctggctcggcacactgatgatgagatgaca
ggctacgtggctaccaggtggtaccgagccccagagatcatgctgaattggatgcactat
aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga
acgttgtttcctggtacagaccatattaaccagcttcagcagataatgcgtctgacgggg
acaccccctgcttatctcattaacaggatgccaagccatgaggcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtcgacctactggagaagatgctcgttttggactcagataagaggatcacagcagcc
caagctcttgcgcatgcctactttgctcagtaccacgaccctgatgatgagcctgttgct
gacccttatgaccagtcctttgaaagcagggaccttctcatagatgagtggaagagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagaaatggagtcc
tga

DBGET integrated database retrieval system