KEGG   Mus musculus (mouse): 26419Help
Entry
26419             CDS       T01002                                 

Gene name
Mapk8, AI849689, JNK, JNK1, Prkm8, SAPK1
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26419 (Mapk8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26419 (Mapk8)
   04010 MAPK signaling pathway
    26419 (Mapk8)
   04012 ErbB signaling pathway
    26419 (Mapk8)
   04310 Wnt signaling pathway
    26419 (Mapk8)
   04668 TNF signaling pathway
    26419 (Mapk8)
   04068 FoxO signaling pathway
    26419 (Mapk8)
   04071 Sphingolipid signaling pathway
    26419 (Mapk8)
   04024 cAMP signaling pathway
    26419 (Mapk8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    26419 (Mapk8)
   04137 Mitophagy - animal
    26419 (Mapk8)
  Cell growth and death
   04210 Apoptosis
    26419 (Mapk8)
   04215 Apoptosis - multiple species
    26419 (Mapk8)
   04217 Necroptosis
    26419 (Mapk8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    26419 (Mapk8)
   04530 Tight junction
    26419 (Mapk8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26419 (Mapk8)
   04621 NOD-like receptor signaling pathway
    26419 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    26419 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    26419 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    26419 (Mapk8)
   04659 Th17 cell differentiation
    26419 (Mapk8)
   04657 IL-17 signaling pathway
    26419 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    26419 (Mapk8)
  Endocrine system
   04910 Insulin signaling pathway
    26419 (Mapk8)
   04920 Adipocytokine signaling pathway
    26419 (Mapk8)
   04912 GnRH signaling pathway
    26419 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    26419 (Mapk8)
   04917 Prolactin signaling pathway
    26419 (Mapk8)
   04926 Relaxin signaling pathway
    26419 (Mapk8)
  Nervous system
   04728 Dopaminergic synapse
    26419 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    26419 (Mapk8)
   04722 Neurotrophin signaling pathway
    26419 (Mapk8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26419 (Mapk8)
  Development
   04380 Osteoclast differentiation
    26419 (Mapk8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    26419 (Mapk8)
   05231 Choline metabolism in cancer
    26419 (Mapk8)
   05210 Colorectal cancer
    26419 (Mapk8)
   05212 Pancreatic cancer
    26419 (Mapk8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    26419 (Mapk8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    26419 (Mapk8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    26419 (Mapk8)
   04931 Insulin resistance
    26419 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    26419 (Mapk8)
  Infectious diseases
   05132 Salmonella infection
    26419 (Mapk8)
   05133 Pertussis
    26419 (Mapk8)
   05152 Tuberculosis
    26419 (Mapk8)
   05166 HTLV-I infection
    26419 (Mapk8)
   05164 Influenza A
    26419 (Mapk8)
   05161 Hepatitis B
    26419 (Mapk8)
   05160 Hepatitis C
    26419 (Mapk8)
   05168 Herpes simplex infection
    26419 (Mapk8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    26419 (Mapk8)
   05169 Epstein-Barr virus infection
    26419 (Mapk8)
   05145 Toxoplasmosis
    26419 (Mapk8)
   05142 Chagas disease (American trypanosomiasis)
    26419 (Mapk8)
  Drug resistance
   01522 Endocrine resistance
    26419 (Mapk8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26419 (Mapk8)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26419 (Mapk8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 26419
NCBI-ProteinID: NP_057909
MGI: 1346861
Ensembl: ENSMUSG00000021936
Vega: OTTMUSG00000018229
UniProt: Q91Y86 Q544A0
Position
14; 14 B
AA seq 384 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctaaaacgataccagaatttaaagcctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcagacccatgctaagcgcgcctaccgagaactagttcttatgaagtgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtcaaa
tcagactgcactttgaagattcttgattttggactggcgaggactgcaggaacgagtttt
atgatgacgccttatgtggtgactcgctactacagagcaccagaggtcattctcggcatg
ggctacaaggagaacgtggacttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
ctcggaacaccttgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacaggcctaaatacgctggatatagctttgagaaactgttccccgatgtgcttttc
ccagctgactcagagcataacaaacttaaagccagtcaggcaagagatttgttatccaaa
atgctagtaatagatgcatccaaaaggatctccgtagatgaagctctccagcacccatac
atcaacgtctggtatgatccttcagaagcagaagccccaccaccaaagatcccggacaag
cagttagatgagagggagcacacaatagaggagtggaaagaactgatatacaaggaggta
atggatttggaggaacgaactaagaatggagtcataagagggcagccgtctcctttagca
caggtgcagcaatga

DBGET integrated database retrieval system