KEGG   Mus musculus (mouse): 26424
Entry
26424             CDS       T01002                                 

Gene name
Nr5a2, AU020803, D1Ertd308, D1Ertd308e, Ftf, LRH, LRH-1, UF2-H3B
Definition
(RefSeq) nuclear receptor subfamily 5, group A, member 2
  KO
K08027  nuclear receptor subfamily 5 group A member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    26424 (Nr5a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    26424 (Nr5a2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    26424 (Nr5a2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    26424 (Nr5a2)
Nuclear receptors [BR:mmu03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   26424 (Nr5a2)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 26424
NCBI-ProteinID: NP_109601
MGI: 1346834
Ensembl: ENSMUSG00000026398
Vega: OTTMUSG00000049882
UniProt: P45448
Structure
PDB: 
1PK5 1ZH7 3F5C

Position
1 59.98 cM; 1 E4
AA seq 560 aa
MSASLDTGDFQEFLKHGLTAIASAPGSETRHSPKREEQLREKRAGLPDRHRRPIPARSRL
VMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYG
LLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRAD
RMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASK
GLPLSHVALPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFPSRAIKSEYPDPYSSSP
ESMMGYSYMDGYQTNSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSA
FGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEG
TIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDV
KNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKH
VNGDVPYNNLLIEMLHAKRA
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtctgctagtttggatactggagattttcaagaatttcttaagcatggacttacagct
attgcgtctgcaccagggtcagagactcgccactcccccaaacgtgaggaacaactccgg
gaaaaacgtgctgggcttccggaccgacaccgacgccccattcccgcccgcagccgcctt
gtcatgctgcccaaagtggagacggaagccccaggactggtccgatcgcatggggaacag
gggcagatgccagaaaacatgcaagtgtctcaatttaaaatggtgaattactcctatgat
gaagatctggaagagctatgtcctgtgtgtggcgataaagtgtctgggtaccattacggt
ctcctcacgtgcgaaagctgcaagggtttttttaagcgaactgtccaaaaccaaaaaagg
tacacgtgcatagagaaccagaattgccaaattgacaaaacgcagagaaaacgatgtccc
tactgtcgattcaaaaaatgtatcgatgttgggatgaagctggaagccgtaagagccgac
cgcatgcgagggggcagaaataagtttgggccaatgtacaagagagacagggctttgaag
cagcagaagaaagccctcattcgagccaatggacttaagctggaagccatgtctcaggtg
atccaagcaatgccctcagacctgacctctgcaattcagaacattcattccgcctccaaa
ggcctacctctgagccatgtagccttgcctccgacagactatgacagaagtccctttgtc
acatctcccattagcatgacaatgccacctcacagcagcctgcatggttaccaaccctat
ggtcactttcctagtcgggccatcaagtctgagtacccagacccctactccagctcacct
gagtcaatgatgggttactcctacatggatggttaccagacaaactccccggccagcatc
ccacacctgatactggaacttttgaagtgtgaaccagatgagcctcaagttcaagcgaag
atcatggcttacctccagcaagagcagagtaaccgaaacaggcaagaaaagctgagcgca
tttgggcttttatgcaaaatggcggaccagaccctgttctccattgttgagtgggccagg
agtagtatcttcttcagggaactgaaggttgatgaccaaatgaagctgcttcaaaactgc
tggagtgagctcttgattctcgatcacatttaccgacaagtggcgcatgggaaggaaggg
acaatcttcctggttactggagaacacgtggactactccaccatcatctcacacacagaa
gtcgcgttcaacaacctcctgagtctcgcacaggagctggtggtgaggctccgttccctt
cagttcgatcagcgggagtttgtatgtctcaagttcctggtgctgttcagctcagatgtg
aagaacctggagaacctgcagctggtggaaggtgtccaagagcaggtgaatgccgccctg
ctggactacacggtttgcaactacccacaacagactgagaaattcggacagctacttctt
cggctacccgagatccgggcaatcagcaagcaggcagaagactacctgtactataagcac
gtgaacggggatgtgccctataataacctcctcattgagatgctgcatgccaaaagagcc
taa

DBGET integrated database retrieval system