KEGG   Mus musculus (house mouse): 26433
Entry
26433             CDS       T01002                                 
Symbol
Plod3, AI414586, LH3
Name
(RefSeq) procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00310  Lysine degradation
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    26433 (Plod3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    26433 (Plod3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    26433 (Plod3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     26433 (Plod3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     26433 (Plod3)
    2.4.1.66  procollagen glucosyltransferase
     26433 (Plod3)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  O-linked Gal type
   26433 (Plod3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy 2OG-FeII_Oxy_3 Anp1 Glyco_tranf_2_3
Other DBs
NCBI-GeneID: 26433
NCBI-ProteinID: NP_036092
MGI: 1347008
Ensembl: ENSMUSG00000004846
UniProt: Q9R0E1
Position
5:137015873..137025500
AA seq 741 aa
MAAAGPEPRLLLLLLLLLPPLPPVTSASDRPRGANAVNPDKLLVITVATAETEGYRRFLQ
SAEFFNYTVRTLGLGQEWRGGDVARTVGGGQKVRWLKKEMEKYADQKDMIIMFVDSYDVI
LASSPTELLKKFVQSGSHLLFSAESFCWPEWGLAEQYPEVGMGKRFLNSGGFIGFAPTIH
QIVRQWNYKDDDDDQLFYTQLYLDPGLREKLKLSLDHKSRIFQNLNGALDEVILKFDQNR
VRIRNVAYDTLPVVVHGNGPTKLQLNYLGNYVPNGWTPQGGCGFCNQTLRTLPGGQPPPR
VLLAVFVEQPTPFLPRFLQRLLLLDYPPDRISLFLHNSEVYHEPHIADAWPQLQDHFSAV
KLVGPEEALSAGEARDMAMDSCRQNPECEFYFSLDADAVLTNPETLRVLIEQNRKVIAPM
LSRHGKLWSNFWGALSPNEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGETLRTELP
QKEVFSSSDTDPDMAFCKSVRDKGIFLHLSNQHEFGRLLATSRYDTDHLHPDLWQIFDNP
VDWREQYIHENYSRALDGEGLVEQPCPDVYWFPLLTEQMCDELVEEMEHYGQWSGGRHED
SRLAGGYENVPTVDIHMKQVGYEDQWLQLLRTYVGPMTEYLFPGYHTKTRAVMNFVVRYR
PDEQPSLRPHHDSSTFTLNVALNHKGVDYEGGGCRFLRYDCRISSPRKGWALLHPGRLTH
YHEGLPTTRGTRYIMVSFVDP
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggctgcggcaggcccggaaccccggcttttgctcctgctcctgctgctgctgccgccg
ctgccccccgtaacttctgcctccgatcgaccccggggcgccaatgctgtcaacccagac
aaattgctggtgatcactgtggctacggcagagacagaggggtaccggcgttttctgcag
tctgcggagttctttaactacactgtacggaccctgggcctgggacaggagtggcgaggg
ggtgatgtggctcgaacagttggtggaggccagaaggtcaggtggctcaagaaggaaatg
gagaaatatgcagatcagaaagacatgatcatcatgtttgtggacagctacgacgtgatt
ctggcaagcagcccgacagagctgctgaagaagtttgttcagagtggcagtcatctgctg
ttctctgctgagagcttctgctggcctgagtgggggctggcagagcagtaccctgaggtg
ggcatggggaagcgcttcctcaactctggtggattcatcggctttgctcccaccatccat
cagattgtccgccagtggaactacaaagacgacgatgatgatcaattgttctacactcaa
ctgtacctggacccagggctgcgggagaaactcaaactgagtctggaccataaatcccgg
atctttcagaacctcaatggagccttagatgaagtgatcttaaagtttgaccagaatcgt
gtgcgcatccggaatgtggcctacgacacacttcctgttgtggtccatggaaatggtccc
actaagctccagctcaactacctggggaactatgtccccaatggctggactccccaggga
ggctgtggattctgcaaccagaccctgaggacactcccgggggggcagcctcccccccgg
gtgcttctggccgtgtttgtggagcagcctactcccttcctgcctcggttcctgcagcgc
ctactgctcctggattaccccccggacaggatctctctcttccttcacaacagcgaggtg
taccacgagcctcatattgcagatgcctggccacagctccaggaccatttttcagctgta
aagctggtggggccagaggaggccctgagcgcaggggaggccagggacatggccatggac
agctgtcggcagaaccctgagtgtgagttctactttagcctggatgctgatgccgtcctt
acgaacccggagaccttgcgtgtcttgattgaacaaaacaggaaggtaatagctcccatg
ctttcccgccatggcaagctctggtccaacttctggggtgccctgagccccaatgagtac
tacgcccgctccgaagactacgtggaactggtgcagcggaagcgagtgggcgtgtggaat
gtaccctacatatctcaggcatatgtgatccgcggggagaccctgaggactgaactgccc
caaaaggaggtattctccagcagcgacacagacccagatatggctttctgcaagagcgtc
cgggacaagggcatcttcctccacctcagcaaccagcacgagtttggccggctgctggct
acttctcgctatgacacagaccacctacacccagacctctggcagatctttgacaaccct
gtggactggagagaacagtacattcacgagaattacagccgggccctggatggggaaggg
ctagtggaacagccatgcccagatgtgtactggttcccactgctgaccgagcagatgtgt
gatgagctggtggaggaaatggaacactatggccagtggtctggaggccggcacgaggat
tccaggttggctggaggatacgagaatgttcccaccgttgatatccacatgaaacaggtg
ggatacgaggaccagtggcttcagctgctgcggacatatgtggggcccatgacggagtac
ctgttccctggctaccacaccaagacacgggcagtgatgaacttcgtggtccgctaccgg
ccagatgagcagccctcgcttcggccacaccatgactcgtccaccttcactctcaatgtc
gccctcaaccacaagggtgtagattatgagggaggcggctgccgcttcctgcgttacgac
tgcagaatctcctctccgaggaaaggctgggccctcctgcaccctggccgcctcacacac
taccatgaggggctgcccaccacccggggtactcgatacatcatggtgtcctttgttgac
ccctga

DBGET integrated database retrieval system