KEGG   Mus musculus (mouse): 26443
Entry
26443             CDS       T01002                                 

Symbol
Psma6, IOTA
Name
(RefSeq) proteasome subunit alpha 6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26443 (Psma6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26443 (Psma6)
   05012 Parkinson disease
    26443 (Psma6)
   05014 Amyotrophic lateral sclerosis
    26443 (Psma6)
   05016 Huntington disease
    26443 (Psma6)
   05017 Spinocerebellar ataxia
    26443 (Psma6)
   05020 Prion disease
    26443 (Psma6)
   05022 Pathways of neurodegeneration - multiple diseases
    26443 (Psma6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26443 (Psma6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26443 (Psma6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26443 (Psma6)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26443 (Psma6)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26443 (Psma6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26443
NCBI-ProteinID: NP_036098
MGI: 1347006
Ensembl: ENSMUSG00000021024
Vega: OTTMUSG00000034926
UniProt: Q9QUM9
Structure
Position
12:55431007..55465244
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccggggttccagcgccggttttgaccgtcacattactatcttctctcccgagggc
cgactctaccaagtagaatatgcttttaaggctattaaccagggtggacttacatctgtt
gctgtcagaggaaaggactgtgcagttattgtcacacagaagaaagtacccgacaaacta
ctggattccagcacagtgactcacttgttcaagataacggaaagcattggctgtgtgatg
acaggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaat
tggaaatacaagtatggctatgaaattcctgtggacatgctgtgcaaaagaattgctgat
atttctcaagtctacacacagaacgctgaaatgaggccactcggttgttgtatgatttta
atcggtatcgatgaagagcaaggccctcaagtgtacaagtgtgatcctgcaggttactac
tgtggctttaaagccacggcggcaggagttaaacaaacagagtcaaccagcttccttgaa
aagaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattaca
tgcctgtctactgttctgtcgattgacttcaaaccttcagaaatagaagttggagtagtt
acagttgaaaatcctaaattcaggattcttactgaagcagagattgacgctcaccttgtt
gctctagcagagagagactga

DBGET integrated database retrieval system