KEGG   Mus musculus (house mouse): 26447
Entry
26447             CDS       T01002                                 
Symbol
Poli, Rad30b
Name
(RefSeq) polymerase (DNA directed), iota
  KO
K03510  DNA polymerase iota [EC:2.7.7.7]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    26447 (Poli)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    26447 (Poli)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     26447 (Poli)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    26447 (Poli)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH Cdd1 UBM HHH_5 DNA_pol_lambd_f
Other DBs
NCBI-GeneID: 26447
NCBI-ProteinID: NP_001129562
MGI: 1347081
Ensembl: ENSMUSG00000038425
UniProt: Q6R3M4 A0A0R4J1Z5
Structure
Position
18:complement(70641751..70668021)
AA seq 674 aa
MISNPELKDRPLGVQQKYLVVTCNYEARKLGVRKLMNVRDAKEKCPQLVLVNGEDLSRYR
EMSYKVTELLEEFSPAVERLGFDENFVDLTEMVEKRLQQLPSEEVPSVTVFGHVYNNQSV
NLHNIMHRRLVVGSQIAAEMREAMYNQLGLTGCAGVAPNKLLAKLVSGVFKPNQQTVLLP
ESCQHLIHSLNHIKEIPGIGYKTAKRLEVLGINSVHDLQTFPIKTLEKELGIAIAQRIQQ
LSFGEDKSPVTPSGPPQSFSEEDTFKKCSSEVEAKAKIEELLSSLLTRVCQDGRKPHTVR
LVIRRYSDKHCNRESRQCPIPSHVIQKLGTGNHDSMPPLIDILMKLFRNMVNVKMPFHLT
LMSVCFCNLKALSSAKKGPMDCYLTSLSTPAYTDKRAFKVKDTHTEDSHKEKEANWDCLP
SRRIESTGTGESPLDATCFPKEKDTSDLPLQALPEGVDQEVFKQLPADIQEEILSGKSRE
NLKGKGSLSCPLHASRGVLSFFSTKQMQASRLSPRDTALPSKRVSAASPCEPGTSGLSPG
STSHPSCGKDCSYYIDSQLKDEQTSQGPTESQGCQFSSTNPAVSGFHSFPNLQTEQLFST
HRTVDSHKQTATASHQGLESHQGLESRELDSAEEKLPFPPDIDPQVFYELPEEVQKELMA
EWERAGAARPSAHR
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgatctccaacccagaattaaaggacagacctttaggtgtgcaacagaaatacttggtg
gttacctgcaactatgaagccaggaaactgggtgtgaggaagcttatgaatgtgagagat
gcgaaggaaaagtgtcctcagctggtcctcgtgaacggagaagacctgagccgctacaga
gagatgtcctataaggtcacagaattgttggaggaatttagtccagctgttgagagactt
ggatttgatgaaaattttgtggatctaacagaaatggtggaaaaaagactccagcagctt
ccaagtgaggaggttccgtcagtgactgtgttcggccatgtttacaataaccagtctgtg
aacctacacaacatcatgcatcggagacttgtggttggatcgcagattgcagcagagatg
cgggaagccatgtataatcagctcgggctcacaggctgcgccggagtggctcctaataaa
ctcttggcaaagttagtgtctggggtttttaaaccaaatcagcagacggtcttactacct
gaaagttgtcaacatctcattcacagtttgaaccacataaaggaaattcctggtatcggc
tataaaactgccaagcgtctcgaagttctgggaatcaatagtgttcatgatctccaaacc
tttccaatcaaaacattagaaaaagaattaggaattgcaattgctcagcgtatccagcag
ctcagttttggagaggacaagtctcccgtcacaccgtcagggccaccacagtcctttagt
gaagaagatacgtttaaaaagtgttcctcagaagtggaagctaaagctaagattgaagaa
ttactttccagccttttgaccagagtatgccaggatggaaggaagccccatacagtaaga
ttagtcatccgtcggtactctgacaaacactgtaatcgagagagtcgtcagtgccctatc
ccatcccacgtcattcagaagttagggacaggaaatcatgactccatgcctcccctgatt
gatatccttatgaaacttttccgaaatatggtgaacgtgaagatgccctttcacctgact
cttatgagcgtgtgcttctgcaacctgaaagccctgagcagtgctaagaaagggcctatg
gactgctacctaacgtccctctcaacccctgcctacaccgacaagcgcgcctttaaagtg
aaggacacccacacggaagactctcacaaggagaaagaagcaaactgggattgtctacca
agtagaagaatcgaaagcacaggaacgggggagtctccgttggatgccacctgttttcct
aaagaaaaagacacaagtgacttgcccctccaggcactgccagagggtgttgatcaagaa
gtctttaagcaacttccagcagatattcaagaagaaatcctttctggaaaatctagagaa
aatctaaaagggaaaggaagtttaagttgtccgctgcatgcctctagaggagtattgtct
ttcttttctacaaagcaaatgcaagccagtcgcttaagccccagagatactgcgctccct
agcaagcgggtatcagctgcatctccctgtgagccgggaacgtcaggactgagccccggg
agcacctcccatccatcgtgcggaaaggactgttcctattacatagacagccagttaaag
gatgagcaaacgagtcaaggccctactgagtctcaaggatgccagttttccagcacgaac
cctgctgtttctggtttccattcctttcctaatctgcagactgaacagctcttctccaca
catcgcactgtagacagccacaagcagacagccaccgcctctcaccagggactagaaagt
caccagggactagaaagcagagagctggattctgcggaagaaaagcttcctttcccacca
gacattgatccgcaagttttctatgagcttccagaagaggtccaaaaggaactgatggcg
gaatgggagagagctggagctgcgcgcccctcggcgcacagataa

DBGET integrated database retrieval system