KEGG   Mus musculus (mouse): 26458
Entry
26458             CDS       T01002                                 

Gene name
Slc27a2, AC, ACSVL1, FAT, FATP2, V, VLCS, Vlac, Vlacs
Definition
(RefSeq) solute carrier family 27 (fatty acid transporter), member 2
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    26458 (Slc27a2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    26458 (Slc27a2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    26458 (Slc27a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    26458 (Slc27a2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    26458 (Slc27a2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     26458 (Slc27a2)
    6.2.1.-  
     26458 (Slc27a2)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   26458 (Slc27a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   26458 (Slc27a2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Codanin-1_C
Other DBs
NCBI-GeneID: 26458
NCBI-ProteinID: NP_036108
MGI: 1347099
Ensembl: ENSMUSG00000027359
Vega: OTTMUSG00000015755
UniProt: O35488 Q3TN99
Position
2; 2 F1
AA seq 620 aa
MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRYFLRLANMARRVRSYRQRRPVRTILRAFL
EQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQLGLRQGDCVALFMGNEPAYVWI
WLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEVLPTLKKDAVSVF
YVSRTSNTNGVDTILDKVDGVSAEPTPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHH
RLWYGTGLAMSSGITAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNTPQKPNDRDHKVKKALGNGLRGDVWREFIKRFGDIHVYE
FYASTEGNIGFVNYPRKIGAVGRANYLQRKVARYELIKYDVEKDEPVRDANGYCIKVPKG
EVGLLVCKITQLTPFIGYAGGKTQTEKKKLRDVFKKGDIYFNSGDLLMIDRENFVYFHDR
VGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASLKIKENYEFNGK
KLFQHIAEYLPSYARPRFLRIQDTIEITGTFKHRKVTLMEEGFNPTVIKDTLYFMDDAEK
TFVPMTENIYNAIIDKTLKL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgctgccagtgctctacaccggcctggcggggctgctgctgctgcctctgctgctcacc
tgctgctgcccctacctcctccaagatgtgcggtacttcctgcggctggccaacatggcc
cggcgggtgcgcagctaccggcagcggcgacccgtgcgtaccatcctgcgggccttcctg
gaacaagcgcgcaagaccccacacaagcccttcctgctgttccgagacgagacgctcacc
tacgcccaggtggaccggcgcagcaaccaagtggcgcgggcgctgcacgatcaactgggc
ctacgacagggggattgcgtagccctcttcatgggcaatgagccggcctacgtgtggatc
tggctgggactgctcaaactgggctgtcccatggcgtgcctcaactacaacattcgtgcc
aagtctctgctgcactgctttcaatgctgcggggcgaaggtgctgctggcctccccagat
ctacaagaagctgtggaggaggttcttccaaccctgaaaaaggatgccgtgtccgtcttt
tacgtaagcagaacttctaacacaaatggtgtggacacaatactggacaaagtagacgga
gtgtcggcggaacccaccccggagtcgtggaggtctgaagtcacttttaccacgccagca
gtatacatttatacttcgggaaccacaggtcttccaaaagcggcaaccatcaatcatcat
cgcctatggtatgggacaggccttgctatgtcgagtggaatcacggcccaggatgtcatc
tataccacaatgcccctgtaccacagtgcagcgctcatgatcggccttcacggatgcatc
gtggttggggctactttagctttgcggagcaaattctcagccagccagttttgggacgac
tgcaggaaatacaacgtcacggtcattcagtacattggtgaactgcttcggtacctgtgc
aacacaccgcagaaaccaaatgaccgggaccacaaagtgaaaaaagccctgggaaatggc
ttacgaggagatgtgtggagagagttcatcaagagatttggggacatccacgtgtatgag
ttctacgcatccactgaaggcaacattggatttgtgaactatccaaggaaaatcggtgct
gtcgggagagcaaactacctacaaagaaaagttgcaaggtatgagctgatcaagtatgac
gtggagaaggacgagccggtccgtgacgcaaatggatattgcatcaaagtccccaaaggt
gaggttggactcttggtttgcaaaatcacacagctcacaccatttattggctatgctgga
ggaaagacccagacagagaagaaaaaactcagagatgtctttaagaaaggcgacatctac
ttcaacagcggagacctcctgatgatcgaccgtgagaacttcgtctactttcacgacagg
gttggagatactttccggtggaaaggagagaacgtagctaccacagaagtcgctgacatc
gtgggactggtagattttgttgaagaagtgaatgtgtatggcgtgcctgtgccaggtcat
gagggtcgaattgggatggcctccctcaagatcaaagaaaactacgagttcaatggaaag
aaactctttcaacacatcgcggagtacctgcccagttacgcgaggcctcggttcctgagg
atacaagataccattgagatcactgggacttttaaacaccgcaaagtgaccctgatggaa
gagggcttcaatcccacagtcatcaaagataccttgtatttcatggatgatgcagagaaa
acatttgtgcccatgactgagaacatttataatgccataattgataaaactctgaagctc
tga

DBGET integrated database retrieval system