KEGG   Mus musculus (mouse): 26557Help
Entry
26557             CDS       T01002                                 

Gene name
Homer2, 9330120H11Rik, AW539445, CPD, Vesl-2
Definition
(RefSeq) homer scaffolding protein 2
  KO
K15010  homer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    26557 (Homer2)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    26557 (Homer2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 Macoilin FlaC_arch Reo_sigmaC GAS CLZ CENP-F_leu_zip DUF812 BST2 SYCE1 MAD DMPK_coil VGPC1_C Jnk-SapK_ap_N TolA_bind_tri DUF1664 ATG16 Effector_1 DUF2046 Phage_GP20 Pox_A_type_inc Dor1 Sec8_exocyst FPP DUF4559 ADIP HALZ Leu_zip TMF_TATA_bd
Motif
Other DBs
NCBI-GeneID: 26557
NCBI-ProteinID: NP_036113
MGI: 1347354
Ensembl: ENSMUSG00000025813
Vega: OTTMUSG00000059182
UniProt: Q9QWW1
Structure
PDB: 

Position
7; 7 D3
AA seq 354 aa AA seqDB search
MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSELQLTKFAEKFQEVREAARLARDKSQEK
TETSSNHSQESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANV
KKWEMELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCSEIN
REKEKNTQLKRRIEELESEVRDKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacagcccatcttcaccacgcgagcgcacgtcttccagattgaccccagcacc
aagaagaactgggtgccggcaagcaagcaggccgtcacggtttcctacttctatgatgtc
accaggaacagctatcggatcatcagtgtggatggagccaaggtgatcataaacagcact
atcaccccgaacatgactttcaccaaaacgtcacagaagttcgggcagtgggctgacagc
agagccaacaccgtgttcggtttgggattctcctccgagctgcagctcacgaagtttgca
gagaagttccaggaggtaagagaagctgccaggctagccagagacaagtcccaggagaaa
accgagacctccagcaatcattcccaagaatctgggtgtgaaaccccgtcttccactcag
gcatccagcgtcaatggcacagacgacgaaaaggcctctcacgcgagcccagccgacact
cacctcaagtctgagaatgacaagctgaagatcgcgctgacacagagtgctgccaatgtg
aagaagtgggagatggagctgcagaccctgcgggagagcaacgcccggctgaccacggca
ctgcaggagtcggcggccagcgtggagcagtggaagcggcagttctccatctgcagggac
gagaatgacaggctccgcagcaagatcgaggagctggaagaacagtgcagcgagataaac
agggagaaggagaagaacacacagctgaagaggaggatcgaggagctggagtcagaggtc
cgagacaaggagatggagttgaaagatctccgaaaacagagtgaaatcatacctcagctc
atgtccgagtgtgaatatgtctctgagaagttagaggcggccgaaagagacaatcaaaac
ttggaagacaaagtgcggtctctaaagacagacatcgaggagagtaaataccgacagcgc
cacctgaagggggagctgaagagcttccttgaggtgctggatggaaagatcgacgacctc
catgacttccgtagaggactctccaagttaggcacagataactag

DBGET integrated database retrieval system